Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Trace amine-associated receptor 5
Species	Mus musculus (Mouse)
Gene	Taar5
Synonym	mTaar5 PNR TAAR5 TaR-5 Trace amine receptor 5 Trimethylamine receptor [ Show all ]
Disease	N/A for non-human GPCRs
Length	337
Amino acid sequence	MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD
UniProt	Q5QD14
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL3784908
IUPHAR	170
DrugBank	N/A

Ligand

Name	trimethylamine
Molecular formula	C3H9N
IUPAC name	N,N-dimethylmethanamine
Molecular weight	59.112
Hydrogen bond acceptor	1
Hydrogen bond donor	0
XlogP	0.3
Synonyms	Trimethylamine, anhydrous, >=99% DSSTox_CID_6238 trimethylamino FEMA Number 3241 KEN MFCD00008327 NCGC00255170-01 STL264242 Trimethylamine solution Trimethylamine solution, 45 wt. % in H2O, FG CHEBI:18139 11062-EP2302015A1 11062-EP2305674A1 11062-EP2269990A1 11062-EP2308854A1 11062-EP2272834A1 11062-EP2311815A1 11062-EP2280001A1 11062-EP2314593A1 11062-EP2284169A1 11062-EP2316836A1 11062-EP2287162A1 20230-89-1 (hydriodide) 11062-EP2292615A1 37851-EP2311796A1 11062-EP2298731A1 59622-EP2277868A1 11062-EP2298828A1 AI3-15639 CTK0I1322 Trimethylamine, aqueous solutions not >50% trimethylamine, by mass [UN1297] [Flammable liquid] DTXSID2026238 UN1083 GTPL5521 LS-1667 N,N,N-trimethylamine NSC-101179 tri-methylamine Trimethylamine 2.0M in THF Trimethylamine solution, 25 wt. % in H2O Trimethylamine, >=99.0% BDBM50416499 11062-EP2305625A1 11062-EP2305679A1 11062-EP2270014A1 11062-EP2308875A1 11062-EP2275411A2 11062-EP2311831A1 11062-EP2281817A1 11062-EP2316825A1 11062-EP2287152A2 11062-EP2380870A1 11062-EP2289891A2 2840-24-6 (hydrobromide) 11062-EP2295409A1 37851-EP2311799A1 11062-EP2298750A1 59622-EP2292608A1 11062-EP2301929A1 Trimethylamine, anhydrous [UN1083] [Flammable gas] Dimethylaminomethylidyneradical Trimethylamine, pure, 4.2M (33 wt.%) solution in ethanol F1908-0091 ZINC112948558 InChI=1/C3H9N/c1-4(2)3/h1-3H Methanamine, N,N-dimethyl- N,N-Dimethylmethanamine # RTR-031873 trimethyl-amine Trimethylamine anhydrous Trimethylamine solution, 31-35 wt. % in ethanol, 4.2 M, contains toluene as stabilizer CAS-75-50-3 11062-EP2305672A1 11062-EP2269977A2 11062-EP2308840A1 11062-EP2272822A1 11062-EP2311808A1 11062-EP2277848A1 11062-EP2314586A1 11062-EP2284149A1 11062-EP2316828A1 11062-EP2287160A1 148083-EP2289884A1 11062-EP2292576A2 37851-EP2301913A1 11062-EP2295433A2 593-81-7 (hydrochloride) 11062-EP2298775A1 AC1L1ATW 11062-EP2301935A1 Trimethylamine, anhydrous, cylinder, with 316SS needle valve, 99% DSSTox_GSID_26238 UN 1083 FT-0660006 KSC181G2F MolPort-000-883-876 NCIOpen2_007868 Tox21_302355 Trimethylamine (ca. 13% in Acetonitrile, ca. 2mol/L) Trimethylamine solution (30% or less) Trimethylamine solution, ~45 wt. % in H2O (T) 11062-EP2305219A1 11062-EP2305677A1 11062-EP2269999A1 11062-EP2308857A1 11062-EP2272841A1 11062-EP2311827A1 11062-EP2280003A2 11062-EP2316457A1 11062-EP2284171A1 11062-EP2377813A1 11062-EP2287163A1 28042-EP2301937A1 11062-EP2295402A2 37851-EP2311797A1 11062-EP2298734A2 59622-EP2277869A1 11062-EP2301923A1 AKOS000119986 D04DOV Trimethylamine, aqueous solutions not >50% trimethylamine, by mass [UN1297] [Flammable liquid] EC 200-875-0 UN1297 HSDB 808 MCULE-7903544426 N,N-dimethyl-Methanamine NSC101179 tridimethylaminomethane Trimethylamine 2M in Isopropanol Trimethylamine solution, 25 wt. % in H2O, FG Trimethylamine, >=99.5% bmse000224 11062-EP2305636A1 (CH3)3N 11062-EP2305682A1 11062-EP2270505A1 11062-EP2308879A1 11062-EP2275412A1 11062-EP2311834A1 11062-EP2281821A1 11062-EP2316826A1 11062-EP2287153A1 11062-EP2380874A2 11062-EP2289965A1 37851-EP2292227A2 11062-EP2295414A1 4558-12-7 11062-EP2298761A1 59622-EP2308852A1 11062-EP2301931A1 Trimethylamine, anhydrous [UN1083] [Flammable gas] Dimethylmethaneamine Trimethylamine, pure, 7.3M (50 wt.%) aqueous solution FEMA No. 3241 ZINC8216125 KB-62087 Methylamine, N,N-dimethyl- N-Trimethylamine SC-46821 Trimethylamin Trimethylamine aqueous solution Trimethylamine solution, 34-36% CCRIS 6283 11062-EP2301936A1 11062-EP2305673A1 11062-EP2269989A1 11062-EP2308851A1 11062-EP2272832A1 11062-EP2311811A1 11062-EP2277867A2 11062-EP2314590A1 11062-EP2284160A1 11062-EP2316831A1 11062-EP2287161A1 19530-21-3 11062-EP2292597A1 37851-EP2301914A1 11062-EP2295437A1 59622-EP2272846A1 11062-EP2298779A1 AC1Q3VWI CHEMBL439723 Trimethylamine, aqueous solutions not >50% trimethylamine, by mass DSSTox_RID_78071 UN 1297 GETQZCLCWQTVFV-UHFFFAOYSA-N LHH7G8O305 N(CH3)3 NMe3 TR-031873 Trimethylamine (ca. 8% in Toluene, ca. 1mol/L) Trimethylamine solution 20 % in H2O Trimethylamine, 1M solution in THF, AcroSeal(R) 11062-EP2305257A1 11062-EP2305678A1 11062-EP2270011A1 11062-EP2308873A1 11062-EP2275398A1 11062-EP2311829A1 11062-EP2280010A2 11062-EP2316458A1 11062-EP2287147A2 11062-EP2380869A1 11062-EP2289510A1 28042-EP2314588A1 11062-EP2295406A1 37851-EP2311798A1 11062-EP2298742A1 59622-EP2277870A1 11062-EP2301928A1 AN-23859 dimethylamino methane Trimethylamine, in aqueous solution EINECS 200-875-0 UNII-LHH7G8O305 Hydrogen undecahydrodicarbaundecaborate(1-), compd. with trimethylamine (1:1) Me3N N,N-dimethylmethanamine RL04874 TRIMETHYL AMINE Trimethylamine 2M solution in methanol Trimethylamine solution, 25 wt. % in propylene glycol Trimethylamine, anhydrous C00565 11062-EP2305651A1 11062-EP2269610A2 11062-EP2308839A1 11062-EP2272491A1 11062-EP2311804A2 11062-EP2275427A1 11062-EP2311842A2 11062-EP2281823A2 11062-EP2316827A1 11062-EP2287155A1 148083-EP2280005A1 11062-EP2292228A1 37851-EP2298732A1 11062-EP2295415A1 11062-EP2298772A1 75-50-3 11062-EP2301933A1 [ Show all ]
Inchi Key	GETQZCLCWQTVFV-UHFFFAOYSA-N
Inchi ID	InChI=1S/C3H9N/c1-4(2)3/h1-3H3
PubChem CID	1146
ChEMBL	CHEMBL439723
IUPHAR	5521
BindingDB	N/A
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
EC50	300.0 nM	PMID16878137	IUPHAR
EC50	2100.0 nM	MedChemComm, (2016) 7:2:353	ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417