Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	P2Y purinoceptor 14
Species	Rattus norvegicus (Rat)
Gene	P2ry14
Synonym	UDP-glucose receptor purinergic receptor P2Y P2Y14 receptor P2Y14 P2Y purinoceptor 14 GPR105 G-protein coupled receptor 105 G protein-coupled receptor 105 G protein coupled receptor for UDP-glucose VTR 15-20 [ Show all ]
Disease	N/A for non-human GPCRs
Length	305
Amino acid sequence	MDNTTTTEPPKQPCTRNTLITQQIIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVFRVSAVIFYVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRKWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLAFVACFAPYHVARIPYTKSQTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPISISSYASRLEKS
UniProt	O35881
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	N/A
IUPHAR	330
DrugBank	N/A

Ligand

Name	Udp galactose
Molecular formula	C15H24N2O17P2
IUPAC name	[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2R,3R,4S,5R,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] hydrogen phosphate
Molecular weight	566.302
Hydrogen bond acceptor	17
Hydrogen bond donor	9
XlogP	-6.3
Synonyms	UDP-delta-galactose Uridine 5'-(trihydrogen diphosphate), P'-a-D-galactopyranosyl ester (9CI) Uridine 5'-pyrophosphate a-delta-galactopyranosyl ester uridine 5'-[3-(alpha-D-galactopyranosyl) dihydrogen diphosphate] Uridine pyrophosphate alpha-d-galactopyranosyl ester [[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2R,3R,4S,5R,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] hydrogen phosphate 2956-16-3 D0K7WW UDP-alpha-D-Galactose UDP-galactose Uridine 5'-diphosphate galactose Uridine 5'-pyrophosphate alpha-delta-galactosyl ester Uridine diphosphate-delta-galactose Uridine pyrophosphogalactose BDBM50209668 GALACTOSE-URIDINE-5'-DIPHOSPHATE UDP-D-galactose Uridine 5'-(alpha-D-galactopyranosyl pyrophosphate) Uridine 5'-pyrophosphate a-D-galactopyranosyl ester Uridine 5'-pyrophosphate, alpha-D-galactosyl ester Uridine pyrophosphate a-D-galactopyranosyl ester Uridinediphosphogalactose HSCJRCZFDFQWRP-ABVWGUQPSA-N UDP-Gal Uridine 5'-(trihydrogen diphosphate), P'-alpha-D-galactopyranosyl ester Uridine 5'-pyrophosphate a-delta-galactosyl ester uridine diphosphate galactose Uridine pyrophosphate alpha-delta-galactopyranosyl ester {[(2R,3S,4R,5R)-5-(2,4-dioxo-1,2,3,4-tetrahydropyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}({[hydroxy({[(2R,3R,4S,5R,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy})phosphoryl]oxy})phosphinic acid DB03501 UDP-a-D-Galactose UDP-alpha-delta-Galactose Udpgal Uridine 5'-diphosphogalactose Uridine 5'-pyrophosphate D-galactosyl ester Uridine diphosphategalactose Uridine-5'-diphosphate-alpha-D-galactose bmse001024 GDU Udp-delta-galactopyranose Uridine 5'-(alpha-delta-galactopyranosyl pyrophosphate) Uridine 5'-pyrophosphate a-D-galactosyl ester Uridine 5'-pyrophosphate, D-galactosyl ester Uridine pyrophosphate a-delta-galactopyranosyl ester ZINC8551104 CHEMBL439009 SCHEMBL1521203 UDP-galactopyranose Uridine 5'-(trihydrogen pyrophosphate), mono-alpha-D-galactopyranosyl ester (8CI) Uridine 5'-pyrophosphate alpha-D-galactosyl ester Uridine diphosphate-D-galactose Uridine pyrophosphate, alpha-D-galactopyranosyl ester AC1L2BAE Galactose-Uridine-5''-Diphosphate UDP-alpha-D-galactopyranose UDP-D-galactopyranose UDPgalactose Uridine 5'-diphosphogalactose disodium salt Uridine 5'-pyrophosphate, alpha-D-galactopyranosyl ester (6CI,7CI) Uridine diphosphogalactose Uridinediphosphate galactose CHEBI:67119 GTPL1782 [ Show all ]
Inchi Key	HSCJRCZFDFQWRP-ABVWGUQPSA-N
Inchi ID	InChI=1S/C15H24N2O17P2/c18-3-5-8(20)10(22)12(24)14(32-5)33-36(28,29)34-35(26,27)30-4-6-9(21)11(23)13(31-6)17-2-1-7(19)16-15(17)25/h1-2,5-6,8-14,18,20-24H,3-4H2,(H,26,27)(H,28,29)(H,16,19,25)/t5-,6-,8+,9-,10+,11-,12-,13-,14-/m1/s1
PubChem CID	18068
ChEMBL	CHEMBL439009
IUPHAR	1782
BindingDB	50209668
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand has more than 5 hydrogen bond donor. This ligand has more than 10 hydrogen bond acceptor. This ligand is heavier than 500 daltons.

Experimental Data

Parameter	Value	Reference	Database source
EC50	79.4328 nM	PMID11735218	IUPHAR

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417