Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Cannabinoid receptor 2
Species	Homo sapiens (Human)
Gene	CNR2
Synonym	Peripheral cannabinoid receptor rCB2 hCB2 cannabinoid receptor 2 (macrophage) cannabinoid receptor 2 (spleen) CB-2 CB2 CB2 receptor CB2-R CX5 [ Show all ]
Disease	Immune disorder Inflammatory bowel disease Inflammatory disease Neuropathic pain Osteoporosis Pain Atopic dermatitis Rheumatoid arthritis [ Show all ]
Length	360
Amino acid sequence	MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
UniProt	P34972
Protein Data Bank	5zty
GPCR-HGmod model	P34972
3D structure model	This structure is from PDB ID 5zty.
BioLiP	BL0438927
Therapeutic Target Database	T37693
ChEMBL	CHEMBL253
IUPHAR	57
DrugBank	BE0000095

Ligand

Name	23981-80-8
Molecular formula	C14H14O3
IUPAC name	2-(6-methoxynaphthalen-2-yl)propanoic acid
Molecular weight	230.263
Hydrogen bond acceptor	3
Hydrogen bond donor	1
XlogP	3.3
Synonyms	alpha-(6-Methoxy-2-naphthyl)propionic acid CHEBI:91939 EINECS 245-969-2 I14-106184 MLS002154184 (+/-)-2-(6-Methoxy-2-naphthyl)propionic Acid NCGC00021127-03 2-(6-Methoxy-2-naphthyl)propanoic acid Panoxen 2-(6-Methoxynaphthalene-2-yl)propanoic acid S(+)-6-methoxy-alpha-methyl-2-naphthaleneacetic acid) 6-methoxy-2naphthyl-alpha-methylacetic acid STK301546 AC1L1B6B BDBM50009860 CS-W009085 HMS2095I11 KS-00001PH5 MolPort-000-889-157 (RS)-2-(6-methoxynaphthalen-2-yl)propanoic acid NCGC00094733-01 2-(6-methoxy-2-naphtyl)propionic acid Proxine 2-naphthaleneacetic acid, 6-methoxy-alpha-methyl- SCHEMBL10029028 6-Methoxy-alpha-methyl-2-naphthaleneessigsaure TRA0033868 ACMC-209g7l AKOS016038194 BSPBio_000169 DL Naproxen HMS3712I11 M1220 (+)2-(6-methoxy-2-naphthyl) propionic acid Naproxen2-(6-Methoxy-naphthalen-2-yl)-propionic acid 1264273-58-6 Niaxan 2-(6-methoxynaphth-2-yl)-propionic acid racemic 2-(6-methoxy-2-naphthyl)propionic acid 4CH-007732 ST024763 AB00513799 ANW-25279 CHEMBL12952 FT-0638374 KB-163190 MLS006011863 (+/-)-6-METHOXY-ALPHA-METHYL-2-NAPHTHALENEACETIC A NCGC00021127-04 2-(6-Methoxy-2-naphthyl)propanoic acid, AldrichCPR Pranoxen 2-Naphthaleneacetic acid, 6-methoxy-.alpha.-methyl-, (.alpha.S)- SBB029869 6-methoxy-alpha-methyl-2-naphthalenacetic acid TC-114024 AC1Q5RT0 AK-40137 BPBio1_000187 CTK7A8174 HMS2230K21 LS-187192 (+)-(S)-6-Methoxy-a-methyl-2-naphthaleneacetic acid Naprosine (RS)-Naproxen NCGC00094733-02 2-(6-Methoxy-naphthalen-2-yl)-propionic acid Q-201030 SCHEMBL145769 6-methoxy-alpha-methyl-2-naphthylacetic acid [S(+)-2-(6-Methoxy-2-naphthyl)propionic acid] ALBB-027257 CCG-220045 DL-Naproxen I06-0050 MCULE-6293512671 (+/-)-2-(6-methoxy-2-naphthyl) propionic acid NCGC00021127-02 2-(6-methoxy-2-naphthyl)-propionic acid Oprea1_018821 2-(6-methoxynaphthalen-2-yl)propanoic acid Racemic Naproxen 6-methoxy-2-naphthyl-alpha-methylacetic acid ST24027595 AC-25684 AS-47598 CMWTZPSULFXXJA-UHFFFAOYSA-N H385 KS-00000H66 Mnpa (+/-)-6-Methoxy-alpha-methyl-2-naphthaleneacetic Acid NCGC00021127-05 2-(6-Methoxy-2-naphthyl)propionic acid Prestwick3_000045 2-Naphthaleneacetic acid, 6-methoxy-.alpha.-methyl-, (S)- SC-78606 6-methoxy-alpha-methyl-2-naphthaleneacetic acid TL8001846 ACMC-209ftj AKOS000121315 BRD-A87719232-001-02-4 DB-007955 HMS3374N03 M-7686 (+)-alpha-(6-methoxy-2-naphthyl)propionic acid Naproxen (racemic) NCGC00094733-03 2-(6-Methoxy-naphthalen-2-yl)-propionic acid(Naproxen) rac-naproxen 26159-31-9 SMR001233475 AB0013024 [ Show all ]
Inchi Key	CMWTZPSULFXXJA-UHFFFAOYSA-N
Inchi ID	InChI=1S/C14H14O3/c1-9(14(15)16)10-3-4-12-8-13(17-2)6-5-11(12)7-10/h3-9H,1-2H3,(H,15,16)
PubChem CID	1302
ChEMBL	N/A
IUPHAR	N/A
BindingDB	N/A
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	<10000.0 nM	http://pdsp.med.unc.edu/pdsp.php	PDSP

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417