Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 2C
Species	Homo sapiens (Human)
Gene	HTR2C
Synonym	Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C 5-HT2C receptor 5-HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled 5-hydroxytryptamine receptor 1C HTR1C 5-HT-1C [ Show all ]
Disease	Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse Generalized anxiety disorder; Major depressive disorder Major depressive disorder Metabolic disorders Psychotic disorders Mood disorder Neurological disease Obesity Obesity; Diabetes Migraine headaches Anxiety disorder Alcohol use disorders Aggressive non-hodgkin's lymphoma [ Show all ]
Length	458
Amino acid sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
UniProt	P28335
Protein Data Bank	6bqg, 6bqh
GPCR-HGmod model	P28335
3D structure model	This structure is from PDB ID 6bqg.
BioLiP	BL0404805, BL0404806
Therapeutic Target Database	T83813
ChEMBL	CHEMBL225
IUPHAR	8
DrugBank	BE0004957, BE0004881, BE0000533

Ligand

Name	5-Methoxy-N,N-dimethyltryptamine
Molecular formula	C13H18N2O
IUPAC name	2-(5-methoxy-1H-indol-3-yl)-N,N-dimethylethanamine
Molecular weight	218.3
Hydrogen bond acceptor	2
Hydrogen bond donor	1
XlogP	1.5
Synonyms	ZINC57152 CHEBI:2086 DB-005455 HMS2235C20 Indole, 3-[2-(dimethylamino)ethyl]-5-methoxy- MeODMT 2-(5-methoxy-1H-indol-3-yl)-N,N-dimethyl-ethanamine N,N-Dimethyl-5-methoxytryptamine, free base 3-(2-Dimethylaminoethyl)-5-methoxyindole; 3-[2-(Dimethylamino)ethyl]-5-methoxyindole; 5-MeO-DMT; 5-Methoxy-DMT; 5-OMe-DMT NCGC00023288-03 5-methoxy-3-N,N-dissopropylamino-ethylindole PDSP1_000447 5-OMe-DMT SDCCGMLS-0003129.P003 BC220661 BRN 0164771 [2-(5-methoxy-1H-indol-3-yl)ethyl]dimethylamine cid_1832 EINECS 213-813-2 I382 Lopac-M-2381 1019-45-0 Methylbufotenine 2-(5-Methoxy-1H-indol-3-yl)-N,N-dimethylethanamine # NCGC00015654-02 3-[2-(N,N-Dimethylamino)ethyl]-5-methoxyindole NSC-88624 5-Methoxy-N,N-dimethyl-1H-indole-3-ethylamine QC-3154 AC1L1CC9 STK368074 WLN: T56 BMJ D2N1&1 GO1 C08309 D-5380 GTPL145 Indole, 3-(2-(dimethylamino)ethyl)-5-methoxy- (8CI) Maybridge3_000045 1H-Indole-3-ethanamine, 5-methoxy-N,N-dimethyl- (9CI) N,N-Dimethyl-5-methoxy tryptamine 3-(2-(N,N-Dimethylamino)ethyl)-5-methoxyindole NCGC00015654-05 5-MeO-DMT Oprea1_596468 5-Methoxydimethyltryptamine SBB003367 ANW-59888 BDBM30707 ZSTKHSQDNIGFLM-UHFFFAOYSA-N HMS3370M04 Indole,N-dimethylamino)ethyl]-5-methoxy- Methoxybufotenin 2-(5-methoxy-1H-indol-3-yl)-N,N-dimethylethan-1-amine N-[2-(5-methoxy-1H-indol-3-yl)ethyl]-N,N-dimethylamine 3-[2-(Dimethylamino)ethyl]-5-methoxyindole NCGC00023288-04 5-Methoxy-DMT PDSP2_000032 AB0013660 SMR000059066 Bufotenine, 5-Methoxydimethyltryptamine [2-(5-methoxyindol-3-yl)ethyl]dimethylamine CT 4334 FT-0082567 IDI1_011432 Lopac0_000724 MFCD00005658 2-(5-methoxy-1H-indol-3-yl)ethyl-dimethyl-amine NCGC00015654-03 NSC88624 RP05082 AKOS005203483 TL8000106 X0MKX3GWU9 CCG-204809 D0C5XQ HMS1431C01 INDOLE, 3-(2-(N,N-DIMETHYLAMINO)ETHYL)-5-METHOXY- MCULE-1161800007 2-(5-methoxy-1H-indol-3-yl)-ethyl-dimethyl-amine N,N-Dimethyl-5-methoxytryptamine 3-(2-Dimethylaminoethyl)-5-methoxyindole NCGC00015654-06 5-MeO-DMT solution, 1.0 mg/mL in methanol, certified reference material PDSP1_000032 5-methoxyindole 3-(2-(N,N-Dimethylamino)ethyl) SCHEMBL132733 API0007109 BRD-K34224286-001-07-1 [2-(5-METHOXY-1H-INDOL-3-YL)-ETHYL]-DIMETHYL-AMINE CHEMBL7257 DTXSID70144324 I05-0003 L000724 019D450 Methoxydimethyltryptamines 2-(5-Methoxy-1H-indol-3-yl)-N,N-dimethylethanamine NCGC00015654-01 3-[2-(N,N-Dimethylamino)ethyl]-5-methoxy-indole NSC 88624 5-Methoxy-N,N-dimethyl-1H-indole-3-ethanamine PDSP2_000445 AB1007126 ST50308247 UNII-X0MKX3GWU9 Bufotenine, O-methyl- CTK3J0837 FT-0601228 Indole, 3-(2-(dimethylamino)ethyl)-5-methoxy- LS-82935 1H-Indole-3-ethanamine, 5-methoxy-N,N-dimethyl- MLS000069438 3-(2-(N,N-Dimethyl)aminoethyl)-5-methoxyindole NCGC00015654-04 5-22-12-00027 (Beilstein Handbook Reference) O-Methylbufotenine 5-Methoxy-N,N-Dimethyltryptamine(5-MeO-DMT) RT-004787 AN-48328 [ Show all ]
Inchi Key	ZSTKHSQDNIGFLM-UHFFFAOYSA-N
Inchi ID	InChI=1S/C13H18N2O/c1-15(2)7-6-10-9-14-13-5-4-11(16-3)8-12(10)13/h4-5,8-9,14H,6-7H2,1-3H3
PubChem CID	1832
ChEMBL	CHEMBL7257
IUPHAR	145
BindingDB	30707
DrugBank	DB14010
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
IC50	250.0 nM	PMID1433172	BindingDB,ChEMBL
Ki	42.0 nM	PMID16392816	BindingDB,ChEMBL
Ki	100.0 - 630.957 nM	PMID10217294	IUPHAR
Ratio	65.0 -	PMID8027974	ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417