Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 2C
Species	Homo sapiens (Human)
Gene	HTR2C
Synonym	Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C 5-HT2C receptor 5-HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled 5-hydroxytryptamine receptor 1C HTR1C 5-HT-1C [ Show all ]
Disease	Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse Generalized anxiety disorder; Major depressive disorder Major depressive disorder Metabolic disorders Psychotic disorders Mood disorder Neurological disease Obesity Obesity; Diabetes Migraine headaches Anxiety disorder Alcohol use disorders Aggressive non-hodgkin's lymphoma [ Show all ]
Length	458
Amino acid sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
UniProt	P28335
Protein Data Bank	6bqg, 6bqh
GPCR-HGmod model	P28335
3D structure model	This structure is from PDB ID 6bqg.
BioLiP	BL0404805, BL0404806
Therapeutic Target Database	T83813
ChEMBL	CHEMBL225
IUPHAR	8
DrugBank	BE0004957, BE0004881, BE0000533

Ligand

Name	3-(1,2,3,6-tetrahydropyridin-4-yl)-1H-indole
Molecular formula	C13H14N2
IUPAC name	3-(1,2,3,6-tetrahydropyridin-4-yl)-1H-indole
Molecular weight	198.269
Hydrogen bond acceptor	1
Hydrogen bond donor	2
XlogP	1.8
Synonyms	3-(1,2,3,6-tetrahydro-pyri-din-4yl)-1h-indole 3-(1,2,3,6-tetrahydropyridine-4-yl)-1H-indole 4-([1H]-indol-3-yl)-1,2,3,6-tetrahydropyridine BBL010213 CTK5C2597 FT-0677342 MolPort-000-159-541 STK801496 3-(1,2,3,6-tetrahydro-4-pyridinyl)-1H-indole 3-(1,2,3,6-tetrahydro-4-pyridinyl)1H-indol 3-(1,2,3,6-tetrahydropyridin-4-yl)indole 3-(4-1,2,5,6-tetrahydropyridyl)indole AC1MC402 DTXSID20375484 KB-86596 SCHEMBL653742 ZINC154399 1H-Indole, 3-(1,2,3,6-tetrahydro-4-pyridinyl)- 3-(1,2,3,6-tetrahydro-4-pyridyl)-1H-indole 3-(1,2,3,6-tetrahydropyridin4-yl)-1H -indole 38620-69-8 AKOS000505683 cid_2761023 FS-1743 MFCD03695471 SR-01000607393-2 3-(1,2,3,6-tetrahydro-4-pyridinyl )-1H-indole 3-(1,2,3,6-Tetrahydro-4-pyridinyl)-1H-indole, AldrichCPR 3-(1,2,3,6-Tetrahydro-pyridin-4-yl)-1H-indole 3-(1,2,3,6tetrahydropyridin-4-yl)-1H-indole 65347-55-9 BDBM31023 D02MVR HMS1377F05 NE12559 THPindole 3-(1,2,3,6-tetrahydro-4-pyridinyl)1H-indole 3-(1,2,3,6-tetrahydropyridin-4yl)-1H-indole AC1Q1GX4 CHEMBL27811 EN300-24706 KS-0000258P SMR000029333 1H-Indole,3-(1,2,3,6-tetrahydro-4-pyridinyl)- 3-(1,2,3,6-tetrahydro-4-pyrinyl)-1h-indole 3-(1,2,3,6-tetrahydropyridin4-yl)-1H-indole 4-([1H]-indol-3-yl)-1,2,3,6-tetrahydro-pyridine BB 0218498 CIRSPTXGPFAXRE-UHFFFAOYSA-N FT-0602348 MLS000093715 ST50342174 3-(1,2,3,6-tetrahydro-4-pyridinyl)-1 H-indole 3-(1,2,3,6-tetrahydro-4-pyridinyl)1-H-indole 3-(1.2,3.6-Tetrahydropyridin-4-yl)-1 H-Indole A823963 CCG-139909 DB-054803 I10-1367 SBB092334 TR-015569 3-(1,2,3,6-tetrahydro-4-pyridyl)-1-H-indole 3-(1,2,3,6-tetrahydropyridin4-yl)- 1H-indole 347T559 AJ-13203 ChemDiv2_002931 F9995-2686 MCULE-8034406494 SR-01000607393 2202AE [ Show all ]
Inchi Key	CIRSPTXGPFAXRE-UHFFFAOYSA-N
Inchi ID	InChI=1S/C13H14N2/c1-2-4-13-11(3-1)12(9-15-13)10-5-7-14-8-6-10/h1-5,9,14-15H,6-8H2
PubChem CID	2761023
ChEMBL	CHEMBL27811
IUPHAR	N/A
BindingDB	31023
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
EC50	163.0 nM	PMID22381048	BindingDB
Ki	296.0 nM	PMID22381048	BindingDB
Ki	632.0 nM	PMID22381048	BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417