Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Adenosine receptor A2a
Species	Homo sapiens (Human)
Gene	ADORA2A
Synonym	RDC8 adenosine receptor A2a A2A receptor A2-AR
Disease	Radionuclide imaging Diabetic foot ulcer Glaucoma Hypertension Neuropathic pain Pain Coronary disorder diagnosis Parkinson's disease Allergic rhinitis Arteriosclerosis Asthma; Chronic obstructive pulmonary disease [ Show all ]
Length	412
Amino acid sequence	MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
UniProt	P29274
Protein Data Bank	4ug2, 4eiy, 3vga, 3vg9, 3uzc, 3uza, 3rfm, 3rey, 3pwh, 5iu4, 3eml, 2ydv, 2ydo, 3qak, 4uhr, 5g53, 5olh, 5olo, 5olv, 5olz, 5om1, 5om4, 5uvi, 5vra, 5wf5, 5wf6, 6aqf, 6gdg, 5olg, 5nm4, 5iu7, 5iu8, 5iua, 5iub, 5jtb, 5k2a, 5k2b, 5mzj, 5mzp, 5n2r, 5nlx, 5nm2
GPCR-HGmod model	P29274
3D structure model	This structure is from PDB ID 4ug2.
BioLiP	BL0213760, BL0350712, BL0350713,BL0350714,BL0350715, BL0353317,BL0353318, BL0357562, BL0357563,BL0357564,BL0357565, BL0357566, BL0357567,BL0357568,BL0357569, BL0379362,BL0379363,BL0379364, BL0379725, BL0379726,BL0379727,BL0379728, BL0379729, BL0385550, BL0350708,BL0350709,BL0350710,, BL0350707, BL0350703,BL0350704,BL0350705,, BL0215974, BL0215975, BL0227995, BL0227996, BL0227997,BL0227998,BL0227999, BL0312021,BL0312022, BL0312023, BL0350692, BL0350693,BL0350694,BL0350695,, BL0350697, BL0350698,BL0350699,BL0350700,, BL0350702, BL0385551,BL0385552,BL0385553, BL0385557, BL0385558,BL0385559,BL0385560,, BL0401931,BL0401932,BL0401933, BL0401934, BL0401935,BL0401936,BL0401937, BL0401938, BL0401939,BL0401940,BL0401941,, BL0401943, BL0401944,BL0401945,BL0401946,, BL0401948, BL0401949,BL0401950,BL0401951,, BL0401954,BL0401955,BL0401956,, BL0405662, BL0405663, BL0401930, BL0401927,BL0401928,BL0401929, BL0401926, BL0385572, BL0385573,BL0385574,BL0385575, BL0393144, BL0393145, BL0393146, BL0393147,BL0393148,BL0393149, BL0393150, BL0393151,BL0393152, BL0398902, BL0398903,BL0398904,BL0398905, BL0401593, BL0401594,BL0401595,BL0401596, BL0414567, BL0213751, BL0401953, BL0379361, BL0130764, BL0130785, BL0152618, BL0194187, BL0195884, BL0199981, BL0200022
Therapeutic Target Database	T77365
ChEMBL	CHEMBL251
IUPHAR	19
DrugBank	BE0000924

Ligand

Name	ENPROFYLLINE
Molecular formula	C8H10N4O2
IUPAC name	3-propyl-7H-purine-2,6-dione
Molecular weight	194.194
Hydrogen bond acceptor	3
Hydrogen bond donor	2
XlogP	0.3
Synonyms	CAS-41078-02-8 D04006 DTXSID9045186 Enprofyllinum [INN-Latin] Lopac-P-5679 NCGC00015824-02 NCGC00022716-03 1H-Purine-2,6-dione, 3,7-dihydro-3-propyl- PDSP1_001202 3-propyl-2,3,6,9-tetrahydro-1H-purine-2,6-dione SR-01000000173-2 AJ-22159 DB00824 Enprofilina [INN-Spanish] HMS2234D09 LS-127057 NCGC00015824-05 NCGC00261595-01 3-n-Propylxanthine SCHEMBL156402 3-Propyl-3,7-dihydro-purine-2,6-dione(enprofylline) UNII-DT7DT5E518 ZB013298 BCP14343 D 4028 DSSTox_RID_80733 Enprofylline [USAN:INN] KB-50533 MolPort-020-915-589 NCGC00015824-08 P 5679 3-Propyl-1H-purine-2,6(3H,9H)-dione SMR000058496 3-Propylxanthine (enprofylline) CCG-204992 D09AMZ EINECS 255-201-8 EU-0100910 Lopac0_000910 NCGC00015824-03 NCGC00022716-04 1H-Purine-2,6-dione,3,9-dihydro-3-propyl- PDSP2_001003 3-propyl-3,7-dihydro-1H-purine-2,6-dione Tox21_110232 AC1L1BZI AKOS006271777 CHEMBL279898 DSSTox_CID_25186 HMS3262F22 MFCD00043205 NCGC00015824-06 Nilyph 3-propyl-1,9-dihydropurine-2,6-dione SCHEMBL18029491 3-propyl-7H-purine-2,6-dione VA10810 ZINC403567 BDBM50001493 D-4028 DT7DT5E518 Enprofyllinum L000242 NCGC00015824-01 NCGC00015824-09 PDSP1_001019 3-propyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione SR-01000000173 41078-02-8 CHEBI:126237 Enprofilina FT-0630617 LP00910 NCGC00015824-04 NCGC00022716-05 3,7-Dihydro-3-propyl-1H-purine-2,6-dione PDSP2_001186 3-Propyl-3,7-dihydro-purine-2,6-dione Tox21_500910 AC1Q6LGE AKOS013464325 CTK4I4231 DSSTox_GSID_45186 Enprofylline (USAN/INN) HMS3369J09 MLS000069700 NCGC00015824-07 Oxeze 3-Propyl-1H-purine-2,6(3H,7H)-dione SIQPXVQCUCHWDI-UHFFFAOYSA-N 3-Propylxanthine Z1945707486 [ Show all ]
Inchi Key	SIQPXVQCUCHWDI-UHFFFAOYSA-N
Inchi ID	InChI=1S/C8H10N4O2/c1-2-3-12-6-5(9-4-10-6)7(13)11-8(12)14/h4H,2-3H2,1H3,(H,9,10)(H,11,13,14)
PubChem CID	1676
ChEMBL	CHEMBL279898
IUPHAR	N/A
BindingDB	50001493
DrugBank	DB00824
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
	N/A	N/A	DrugBank
EC50	7200.0 nM	PMID1331453	BindingDB,ChEMBL
Ki	<10000.0 nM	PMID3010074, PMID2997628, PMID10496952, PMID19569717	PDSP,BindingDB
Ki	32000.0 nM	PMID19569717	BindingDB,ChEMBL
Ki	81300.0 nM	PMID16759111	BindingDB,ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417