Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	P2Y purinoceptor 4
Species	Rattus norvegicus (Rat)
Gene	P2ry4
Synonym	UNR pyrimidinoceptor pyrimidinergic receptor P2Y P2Y4R P2Y4 receptor P2Y4 P2Y purinoceptor 4 P2Y ATP receptor 4 NRU uridine nucleotide receptor [ Show all ]
Disease	N/A for non-human GPCRs
Length	361
Amino acid sequence	MTSAESLLFTSLGPSPSSGDGDCRFNEEFKFILLPMSYAVVFVLGLALNAPTLWLFLFRLRPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGLCKFVRFLFYWNLYCSVLFLTCISVHRYLGICHPLRAIRWGRPRFASLLCLGVWLVVAGCLVPNLFFVTTNANGTTILCHDTTLPEEFDHYVYFSSAVMVLLFGLPFLITLVCYGLMARRLYRPLPGAGQSSSRLRSLRTIAVVLTVFAVCFVPFHITRTIYYQARLLQADCHVLNIVNVVYKVTRPLASANSCLDPVLYLFTGDKYRNQLQQLCRGSKPKPRTAASSLALVTLHEESISRWADTHQDSTFSAYEGDRL
UniProt	O35811
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL2124
IUPHAR	325
DrugBank	N/A

Ligand

Name	uridine 5'-triphosphate
Molecular formula	C9H15N2O15P3
IUPAC name	[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate
Molecular weight	484.139
Hydrogen bond acceptor	15
Hydrogen bond donor	7
XlogP	-5.8
Synonyms	uridintriphosphat 63-39-8 [[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate BDBM50118213 CHEMBL336296 DB04005 HY-107372 KBio2_007313 SCHEMBL76682 uridine 5''-(tetrahydrogen triphosphate) Uridine mono(tetrahydrogen triphosphate) 2,4(1H,3H)-Pyrimidinedione, 1-[5-O-[hydroxy[[hydroxy(phosphonooxy)phosphinyl]oxy]phosphinyl]-.beta.-D-ribofuranosyl]- 4-24-00-01222 (Beilstein Handbook Reference) UTP AJ-75025 BSPBio_003192 D0W1NH DTXSID0041147 INS 316 KBioSS_002177 Spectrum3_001596 Uridine 5'-(tetrahydrogen triphosphate) (8CI,9CI) Uridine, 5'-(tetrahydrogen triphosphate) 5'-UTP [(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl (hydroxy-phosphonooxyphosphoryl) hydrogen phosphate AN-41856 CHEBI:15713 D0Z7FU GTPL1734 KBio2_002177 NINDS_000269 Spectrum_001697 Uridine 5'-triphosphoric acid Uridine5'-(tetrahydrogen triphosphate) UT0S826Z60 AC1L1LV9 [[[5-(2,4-Dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxyphosphonic acid bmse000295 CS-7777 DC99D596-4755-4E87-B3AA-F1D6CFEDCE9A I14-101793 KBio3_002692 SPBio_000509 uridine 5''-triphosphoric acid uridine tetrahydrogen triphosphate 266356-22-3 5''-UTP VZ34081 AK122022 C00075 D0W1XX EINECS 200-558-7 INS316 LS-160841 Spectrum4_000851 ((2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methyl tetrahydrogen triphosphate Uridine, mono(tetrahydrogen triphosphate) (ester) uridine5'-triphosphate [[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl]methoxy-hydroxy-phosphoryl] phosphono hydrogen phosphate AX8156257 DB-054470 H4utp KBio2_004745 PGAVKCOVUIYSFO-XVFCMESISA-N UNII-UT0S826Z60 Uridine 5_-triphosphate 19817-92-6 Uteplex AC1Q1I4F BRN 0071520 CTK5B8994 DivK1c_000269 IDI1_000269 KBioGR_001481 Spectrum2_000525 Uridine 5'-(tetrahydrogen triphosphate) uridine triphosphate 3h-uridine triphosphate 5'-URIDYLATE TRIPHOSPHATE ZINC3861755 AKOS016011172 C9H15N2O15P3 D0Y1ZP FT-0631282 KBio1_000269 NCGC00163323-01 Spectrum5_001167 Uridine 5'-triphosphate sodium salt, AldrichCPR 063U398 uridine-5'-triphosphate [ Show all ]
Inchi Key	PGAVKCOVUIYSFO-XVFCMESISA-N
Inchi ID	InChI=1S/C9H15N2O15P3/c12-5-1-2-11(9(15)10-5)8-7(14)6(13)4(24-8)3-23-28(19,20)26-29(21,22)25-27(16,17)18/h1-2,4,6-8,13-14H,3H2,(H,19,20)(H,21,22)(H,10,12,15)(H2,16,17,18)/t4-,6-,7-,8-/m1/s1
PubChem CID	6133
ChEMBL	CHEMBL336296
IUPHAR	1734
BindingDB	50118213
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand has more than 5 hydrogen bond donor. This ligand has more than 10 hydrogen bond acceptor.

Experimental Data

Parameter	Value	Reference	Database source
EC50	2511.89 nM	PMID9647463	IUPHAR
EC50	2600.0 nM	PMID12213051	BindingDB,ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417