Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Muscarinic acetylcholine receptor M4
Species	Bos taurus (Bovine)
Gene	CHRM4
Synonym	N/A
Disease	N/A for non-human GPCRs
Length	126
Amino acid sequence	MKQSVKKPPPPGDTTVRGELPNGKLEEAPPPVLPPPPRPMADKDTSNESSSGSATQNTKERPPTELSTTEATTPATPAPPLQPRTLNPASKWSKIQIVTKQTGNECVTAIEIVPATPAGMRPAANV
UniProt	P41986
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	N/A
IUPHAR	N/A
DrugBank	N/A

Ligand

Name	tropicamide
Molecular formula	C17H20N2O2
IUPAC name	N-ethyl-3-hydroxy-2-phenyl-N-(pyridin-4-ylmethyl)propanamide
Molecular weight	284.359
Hydrogen bond acceptor	3
Hydrogen bond donor	1
XlogP	1.5
Synonyms	HMS1921I09 Spectro-Cyl HMS3373B07 SR-01000075351-1 IDI1_000448 SW196691-3 AC1L1KOZ KBioSS_001064 Tropicamid AN-15530 Medical Ophthalmics Brand of Tropicamide Tropicamide Faure Benzeneacetamide,N-ethyl-a-(hydroxymethyl)-N-(4-pyridinylmethyl)- Mydriacyl (TN) Tropicamide Pharmafair Brand BRN 0285563 N-ethyl-3-hydroxy-2-phenyl-N-(pyridin-4-ylmethyl)propanamide Tropicamide, solid CHEBI:9757 NCGC00016065-05 D00397 Prestwick1_000228 NCGC00024866-04 DTXSID8045220 s1913 NSC_5593 SCHEMBL23975 Ocumed Brand of Tropicamide HMS2095N17 Spectrum3_000655 (+-)-N-Ethyl-2-phenyl-N-(4-pyridylmethyl)hydracrylamide HMS501G10 SR-01000075351-7 AB00052120_11 KBio2_001064 Tox21_110297 AK164485 L001262 BCP13504 MLS001306442 Tropicamide Monofree Bistropamide Mydrum Tropicamide [USAN:USP:INN:BAN:JAN] Cahill May Roberts Brand of Tropicamide N-Ethyl-N-(4-pyridylmethyl)tropamide Tropicamidum [INN-Latin] Colircusi Tropicamida Opticyl NCGC00016065-08 DB00809 Prestwick_487 NCGC00261908-01 Epitromina GTPL7319 SPBio_000872 HMS3263F08 Spectrum_000584 5-22-09-00359 (Beilstein Handbook Reference) I-Picamide Stulln Brand 1 of Tropicamide AB2000370 KBio3_001509 Triaminic DM Alcon Brand of Tropicamide LS-28545 Tropicamide Alcon Brand Benzeneacetamide, N-ethyl-alpha-(hydroxymethyl)-N-(4-pyridinylmethyl)- Mydral Tropicamide Novartis Brand BRD-A79672927-001-05-8 N-Ethyl-3-hydroxy-2-phenyl-N-(4-pyridinylmethyl)propanamide # Tropicamide, (S)-Isomer CCG-40076 NCGC00016065-03 Visumidriatic CS-2362 Pharmakon1600-01500599 NCGC00024866-02 DSSTox_GSID_45220 Ro 1-7683 NSC-757372 HMS2089M05 SPECTRUM1500599 HMS3651K04 SR-01000075351-3 AB00052120 K-4793 T 9778 AC1Q5IFA KS-00000H8Q Tropicamida API0004531 MFCD00058580 Tropicamide for peak identification, European Pharmacopoeia (EP) Reference Standard BG0349 Mydriafair Tropicamide Rivex Brand BSPBio_000275 N-Ethyl-alpha-(hydroxymethyl)-N-(4-pyridinylmethyl)benzeneacetamide Tropicamide, United States Pharmacopeia (USP) Reference Standard NCGC00016065-06 D09PNY Prestwick2_000228 NCGC00024866-05 EBD22886 SAM002564235 Ocu Tropic SMP1_000304 Ocusoft Brand of Tropicamide HMS2235J15 Spectrum4_000377 HY-B0321 ST51015162 AB00052120_12 KBio2_003632 Tox21_110297_1 Akorn Brand of Tropicamide Lopac0_001223 Tropicamide (JP15/USP/INN) BDBM82371 MLS002154240 Tropicamide Monohydrochloride, (R)-Isomer Bournonville Brand of Tropicamide N-Ethyl-2-phenyl-N-(4-pyridylmethyl)hydracrylamide Tropicamide, (+-)-Isomer CAS-1508-75-4 n-ethyl-n-(g-picolyl)tropamide Tropikamid component of Paremyd Paremyd NCGC00016065-09 DivK1c_000448 Q-201902 NINDS_000448 EU-0101223 HMS1568N17 SPBio_002196 HMS3267A13 SR-01000075351 508T754 I06-0811 Stulln Brand 2 of Tropicamide AC-816 KBioGR_000873 Tropicacyl AM84467 MCULE-4102613027 Tropicamide Chauvin Brand Benzeneacetamide, N-ethyl-alpha-(hydroxymethyl)-N-(4-pyridinylmethyl)-, (+-)- Mydriacyl Tropicamide Ocumed Brand BRD-A79672927-001-10-8 N-ethyl-3-hydroxy-2-phenyl-N-(4-pyridylmethyl)propanamide Tropicamide, European Pharmacopoeia (EP) Reference Standard Chauvin Brand of Tropicamide NCGC00016065-04 CTK4C6796 Prestwick0_000228 NCGC00024866-03 DSSTox_RID_80757 RP29909 NSC757372 Ocu-Tropic HMS2092A18 Spectrum2_000936 HMS3712N17 SR-01000075351-5 AB00052120-10 KBio1_000448 TL8001101 ACN-036667 KS-5174 Tropicamida [INN-Spanish] BBL028074 Minims tropicamide Tropicamide Minims BGDKAVGWHJFAGW-UHFFFAOYSA-N Mydriaticum Tropicamide [USAN:INN:BANJAN] BSPBio_002289 N-Ethyl-N-(4-pyridylmethyl)tropamid Tropicamidum CHEMBL1200604 NCGC00016065-07 Prestwick3_000228 NCGC00024866-06 EINECS 216-140-2 SBI-0051190.P003 SMR000058523 OcuTropic HMS3259M18 Spectrum5_001585 1508-75-4 Hydracrylamide, N-ethyl-2-phenyl-N-(4-pyridylmethyl)- STK934612 AB0011259 KBio2_006200 Tox21_501223 AKOS005664076 LP01223 Tropicamide (JP17/USP/INN) Benzeneacetamide, N-ethyl-.alpha.-(hydroxymethyl)-N-(4-pyridinylmethyl)- MolPort-000-159-321 Tropicamide Monohydrochloride, (S)-Isomer BPBio1_000303 N-Ethyl-2-phenyl-N-4-[-pyridyl-methyl]hydracrylamide Tropicamide, (R)-Isomer CAS_1508-75-4 NC00589 Tropimil CPD000058523 Pharmafair Brand of Tropicamide NCGC00016065-11 DSSTox_CID_25220 Rivex Brand of Tropicamide Novartis Brand of Tropicamide FT-0657590 [ Show all ]
Inchi Key	BGDKAVGWHJFAGW-UHFFFAOYSA-N
Inchi ID	InChI=1S/C17H20N2O2/c1-2-19(12-14-8-10-18-11-9-14)17(21)16(13-20)15-6-4-3-5-7-15/h3-11,16,20H,2,12-13H2,1H3
PubChem CID	5593
ChEMBL	CHEMBL1200604
IUPHAR	N/A
BindingDB	82371
DrugBank	DB00809
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	57.54 nM	PMID9834968	PDSP

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417