Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	N-formyl peptide receptor 2
Species	Homo sapiens (Human)
Gene	FPR2
Synonym	FPRH1 FPRH2 FPRL1 HM63 Lipoxin A4 receptor LXA4 receptor LXA4R FPR2A FPR2/ALX Fpr-rs2 ALX ALX/FPR2 ALXR FMLP-R-I FMLP-related receptor I FMLPX formyl peptide receptor 2 formyl peptide receptor, related sequence 2 Formyl peptide receptor-like 1 RFP [ Show all ]
Disease	N/A
Length	351
Amino acid sequence	METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
UniProt	P25090
Protein Data Bank	N/A
GPCR-HGmod model	P25090
3D structure model	This predicted structure model is from GPCR-EXP P25090.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL4227
IUPHAR	223
DrugBank	N/A

Ligand

Name	4-Aminodiphenylamine
Molecular formula	C12H12N2
IUPAC name	4-N-phenylbenzene-1,4-diamine
Molecular weight	184.242
Hydrogen bond acceptor	2
Hydrogen bond donor	2
XlogP	2.5
Synonyms	Z234894423 TRA0005500 MolPort-000-927-989 N-Phenyl-1,4-phenylenediamine AC1Q1IM4 n1-phenyl-1,4-benzenediamine ANW-43066 NCGC00254187-01 C.I. oxidation base 2 NSC37074 CHEBI:59038 P-AMINODIPHENYLAMINE cid_7564 paraaminodiphenylamine DSSTox_GSID_25895 SCHEMBL15371 FT-0617574 KB-258528 101-54-2 Variamine Blue RT STL263880 4'-Bianiline N-4'-Bianiline 4698-29-7 (sulfate [2:1]) N-phenyl-p-phenylene diamine acnablackdfbase Naphthoelan Navy Blue Azosalt R NE10520 C.I. Azoic Diazo Component 22 Oxy Acid Black Base CI 37240 p-Phenylenediamine, N-phenyl- Diphenyl Black phenyl 4-aminophenyl amine EC 202-951-9 SMR000129304 HMS2487O23 (4-aminophenyl)phenylamine LS-331 W-108912 Tox21_300027 MFCD00007850 4-(Phenylamino)aniline N-Phenyl-1,4-benzenediamine AC-10080 N-Phenyl-p-phenylenediamine, capsule (15??mg) AKOS000120208 NCGC00164239-03 Black Base P NSC-37074 CAS-101-54-2 p-Aminodifenylamin [Czech] CI Developer 15 P260 Diphenylamine, p-amino- RTR-000392 F0900-1525 InChI=1/C12H12N2/c13-10-6-8-12(9-7-10)14-11-4-2-1-3-5-11/h1-9,14H,13H 1,4-Benzenediamine, N1-phenyl- ZB004812 ST029306 UBOB 12227-74-6 N, 4'-Bianiline 4-benzenediamine,n-phenyl-1 N-Phenyl-benzene-1,4-diamine AC1Q523C N1-phenylbenzene-1,4-diamine ATGUVEKSASEFFO-UHFFFAOYSA-N NCGC00259693-01 C.I. 37240 Oprea1_628520 p-AMINODIPHENYLAMINE, TECH CJ-01033 Peltol BR DSSTox_RID_77963 Semidin FT-0654824 KB-36520 Variamine Blue RT Base TL8000096 4-(N-phenylamino)-aniline N-Fenyl-p-fenylendiamin N-Phenyl-p-phenylenediamine AI3-15983 NCGC00164239-01 BB 0221229 NSC 3401 C.I. Developer 15 p-(Phenylamino)aniline CI 76085 p-Semidine diphenyl black base P Rodol Gray B base EINECS 202-951-9 SR-01000393954 HSDB 2178 007X4XXS71 Luxan Black R WLN: ZR DMR TR-000392 MLS000518884 4-amino-diphenylamin N-phenyl-1,4-diaminobenzene AC1L1P1S N-phenylbenzene-1,4-diamine AN-24580 NCGC00164239-04 BRD-K47738216-003-01-9 NSC3401 CCRIS 513 p-aminodiphenylamin CI Oxidation Base 2 para-aminodiphenylamine DSSTox_CID_5895 SBB056688 Fast Blue R Salt Jsp000227 1-N-phenylbenzene-1,4-diamine ZINC136186 ST24031464 UNII-007X4XXS71 2198-59-6 (mono-hydrochloride) N-(4-Aminophenyl)aniline 4-N-phenylbenzene-1,4-diamine N-Phenyl-p-aminoaniline Acna Black DF Base N4-phenylbenzene-1,4-diamine Azoic diazo 22 (C.I. 37240) NCI-C02233 C.I. 76085 oxy acid black base CHEMBL572203 p-Anilinoaniline CTK3J6850 Peltol BR II DTXSID7025895 Semidine FT-0694840 KSC496Q5B Variamine Blue Salt RT Tox21_202144 MCULE-6038560098 4-(phenylamino) aniline N-Fenyl-p-fenylendiamin [Czech] 76600-63-0 N-Phenyl-p-phenylenediamine, 98% AJ-12299 NCGC00164239-02 BDBM50303914 NSC-3401 C.I. Oxidation Base 2 p-Aminodifenylamin CI Azoic Diazo Component 22 P0203 Diphenylamine, 4-amino- RP24476 Epitope ID:122685 SR-01000393954-1 I01-9814 1,4-Benzenediamine, N-phenyl- [ Show all ]
Inchi Key	ATGUVEKSASEFFO-UHFFFAOYSA-N
Inchi ID	InChI=1S/C12H12N2/c13-10-6-8-12(9-7-10)14-11-4-2-1-3-5-11/h1-9,14H,13H2
PubChem CID	7564
ChEMBL	CHEMBL572203
IUPHAR	N/A
BindingDB	50303914
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
IC50	<66700.0 nM	N/A	BindingDB
Ki	<40300.0 nM	N/A	BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417