Structure of PDB 6z80 Chain T |
>6z80T (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] |
MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD DPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHK |
|
PDB | 6z80 A hybrid approach reveals the allosteric regulation of GTP cyclohydrolase I. |
Chain | T |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PHE |
T |
I10 Q75 |
I10 Q75 |
|
|
|
|