Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 7na7 Chain R

Receptor sequence >7na7R (length=291) Species: 9606 (Homo sapiens) [Search protein sequence] PAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFS DLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYAKVLTITALS VERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHEQ GTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRK LWRRRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQ ISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGF

3D structure PDB 7na7 Structural basis of human ghrelin receptor signaling by ghrelin and the synthetic agonist ibutamoren Chain R Resolution 2.7 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 peptide R L103 Y106 R107 E124 M213 F279 R283 F286 S289 F290 N305 L306 S308 F309 L65 Y68 R69 E86 M175 F230 R234 F237 S240 F241 N256 L257 S259 F260 BS02 CLR R F87 K161 W168 F172 F49 K123 W130 F134 BS03 CLR R T135 V139 V170 L223 T97 V101 V132 L185

Gene Ontology Molecular Function GO:0001616 growth hormone secretagogue receptor activity GO:0004930 G protein-coupled receptor activity GO:0016520 growth hormone-releasing hormone receptor activity GO:0017046 peptide hormone binding GO:0042562 hormone binding

	Biological Process
GO:0007165	signal transduction
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007283	spermatogenesis
GO:0007565	female pregnancy
GO:0007611	learning or memory
GO:0008154	actin polymerization or depolymerization
GO:0008343	adult feeding behavior
GO:0009725	response to hormone
GO:0009755	hormone-mediated signaling pathway
GO:0010700	negative regulation of norepinephrine secretion
GO:0030252	growth hormone secretion
GO:0032094	response to food
GO:0032099	negative regulation of appetite
GO:0032100	positive regulation of appetite
GO:0032354	response to follicle-stimulating hormone
GO:0032355	response to estradiol
GO:0032691	negative regulation of interleukin-1 beta production
GO:0032715	negative regulation of interleukin-6 production
GO:0032720	negative regulation of tumor necrosis factor production
GO:0032869	cellular response to insulin stimulus
GO:0036321	ghrelin secretion
GO:0040018	positive regulation of multicellular organism growth
GO:0043134	regulation of hindgut contraction
GO:0043568	positive regulation of insulin-like growth factor receptor signaling pathway
GO:0045923	positive regulation of fatty acid metabolic process
GO:0045927	positive regulation of growth
GO:0046676	negative regulation of insulin secretion
GO:0046697	decidualization
GO:0048009	insulin-like growth factor receptor signaling pathway
GO:0050728	negative regulation of inflammatory response
GO:0051963	regulation of synapse assembly
GO:0051969	regulation of transmission of nerve impulse
GO:0060123	regulation of growth hormone secretion
GO:0060259	regulation of feeding behavior
GO:0060416	response to growth hormone
GO:0071222	cellular response to lipopolysaccharide
GO:0071548	response to dexamethasone
GO:0090327	negative regulation of locomotion involved in locomotory behavior
GO:0097067	cellular response to thyroid hormone stimulus
GO:0098696	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
GO:0099170	postsynaptic modulation of chemical synaptic transmission
GO:0099175	regulation of postsynapse organization
GO:0120058	positive regulation of small intestinal transit
GO:1902065	response to L-glutamate
GO:1903672	positive regulation of sprouting angiogenesis
GO:1904000	positive regulation of eating behavior
GO:1904349	positive regulation of small intestine smooth muscle contraction
GO:1905333	regulation of gastric motility
GO:1905564	positive regulation of vascular endothelial cell proliferation
GO:1990314	cellular response to insulin-like growth factor stimulus
GO:2000110	negative regulation of macrophage apoptotic process

	Cellular Component
GO:0005886	plasma membrane
GO:0009986	cell surface
GO:0016020	membrane
GO:0043005	neuron projection
GO:0045121	membrane raft
GO:0097060	synaptic membrane
GO:0098685	Schaffer collateral - CA1 synapse
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component