Structure of PDB 8smr Chain K

Receptor sequence

>8smrK (length=181) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]

AGDAAAGQAKAAVCGACHGADGNSPAPNFPKLAGQGERYLLKQMHDIKDG
KRTVLEMTGLLTNLSDQDLADIAAYFASQKMSVGMADPNLVAQGEALFRG
GKIAEGMPACTGCHSPSGVGIATAGFPHLGGQHATYVAKQLTDFREGTRT
NDGDTKIMQSIAAKLSNKDIAAISSYIQGLH

3D structure

PDB

8smr Structure of the bc 1 - cbb 3 respiratory supercomplex from Pseudomonas aeruginosa.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	K	M105 A106 P108 V111 R119 P136 Y196 G199 L200 H201	M85 A86 P88 V91 R99 P116 Y176 G179 L180 H181
BS02	HEC	K	Y59 K62 Q63 C130 C133 H134 F146 P147 L149 Y156 L161 R169 N171 D172 I177 M178 I181 I193	Y39 K42 Q43 C110 C113 H114 F126 P127 L129 Y136 L141 R149 N151 D152 I157 M158 I161 I173
BS03	HEC	K	C34 C37 H38 F49 P50 L52 Y59 M64 R72 V74 E76 M77 L80 Y156 K159 Q160	C14 C17 H18 F29 P30 L32 Y39 M44 R52 V54 E56 M57 L60 Y136 K139 Q140

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Cellular Component
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:8smr, PDBe:8smr, PDBj:8smr
PDBsum	8smr
PubMed	37751552
UniProt	P00106\|CYC4_PSEAE Cytochrome c4 (Gene Name=cc4)

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417