Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 4xvu Chain H

Receptor sequence >4xvuH (length=311) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLL ISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMGAL ADLTGSIPGIDEALSFMEVMKHIKRQEQGETFDTVIFDTAPTGHTLRFLQ LPNTLSKLLEKFGEITNKLGISGKLNELKANVETIRQQFTDPDLTTFVCV CISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQAR WKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPI TDGKVIYELED

3D structure PDB 4xvu Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Chain H Resolution 2.35 Å 3D structure Catalytic site residues are labeled in the structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Catalytic site (original residue number in PDB) G28 G30 K31 T32 T33 N57 Catalytic site (residue number reindexed from 1) G25 G27 K28 T29 T30 N54 Enzyme Commision number 3.6.-.-

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 peptide H M97 M143 M94 M117 BS02 ATP H K26 G27 E245 L247 K23 G24 E204 L206 BS03 ZN H C285 C288 C244 C247 BS04 ATP H G27 G28 G30 K31 T32 T33 N272 L316 C317 I321 F330 G24 G25 G27 K28 T29 T30 N231 L275 C276 I280 F289

Gene Ontology Molecular Function GO:0005085 guanyl-nucleotide exchange factor activity GO:0005515 protein binding GO:0005524 ATP binding GO:0008270 zinc ion binding GO:0016787 hydrolase activity GO:0016887 ATP hydrolysis activity GO:0042802 identical protein binding GO:0044183 protein folding chaperone GO:0046872 metal ion binding GO:0051082 unfolded protein binding

	Biological Process
GO:0000750	pheromone-dependent signal transduction involved in conjugation with cellular fusion
GO:0006457	protein folding
GO:0006620	post-translational protein targeting to endoplasmic reticulum membrane
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0009408	response to heat
GO:0010038	response to metal ion
GO:0016192	vesicle-mediated transport
GO:0034599	cellular response to oxidative stress
GO:0045048	protein insertion into ER membrane
GO:0046685	response to arsenic-containing substance
GO:0071816	tail-anchored membrane protein insertion into ER membrane

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0043529	GET complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component