Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 8wtb Chain B

Receptor sequence
>8wtbB (length=99) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
ISACPKCGMTFQQFRKIGRFGCSECYKTFHSNITPILRKVHSGNTVHAGK
IPKRIGGNLHVRRQIDMLKKELESLIHQEEFENAAHVRDQIRLLEQSLK
3D structure
PDB8wtb Structural insights into the regulation of protein-arginine kinase McsB by McsA.
ChainB
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B C81 C84 C99 C102 C4 C7 C22 C25
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0008270 zinc ion binding
GO:0046870 cadmium ion binding
GO:0050897 cobalt ion binding
Biological Process
GO:0006508 proteolysis
GO:1990169 stress response to copper ion
GO:1990170 stress response to cadmium ion

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8wtb, PDBe:8wtb, PDBj:8wtb
PDBsum8wtb
PubMed38625935
UniProtP37569|MCSA_BACSU Protein-arginine kinase activator protein (Gene Name=mcsA)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417