Structure of PDB 4e7o Chain B |
>4e7oB (length=131) Species: 171101 (Streptococcus pneumoniae R6) [Search protein sequence] |
HMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDI AILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDA YVLKERSIADLMQTLHTVLEGRKEYSPELME |
|
PDB | 4e7o Crystal structure of receiver domain of putative NarL family response regulator spr1814 from Streptococcus pneumoniae in the absence and presence of the phosphoryl analog beryllofluoride. |
Chain | B |
Resolution | 2.198 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
D8 D53 E55 |
D9 D54 E56 |
|
|
|
|