Structure of PDB 4z9v Chain A

Receptor sequence

>4z9vA (length=153) Species: 9606 (Homo sapiens) [Search protein sequence]

HMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAF
SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESV
DKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRK
GQE

3D structure

PDB

4z9v TCTP contains a BH3-like domain, which instead of inhibiting, activates Bcl-xL.

Chain

Resolution

2.099 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	F97 R100 Y101 F105 E129 L130 D133 N136 G138 R139 A142 Y195	F42 R45 Y46 F50 E74 L75 D78 N81 G83 R84 A87 Y140
BS02	peptide	A	V155 Q160 S164 R165	V100 Q105 S109 R110
BS03	peptide	A	R6 G21 Y22 S23 W24	R7 G22 Y23 S24 W25
BS04	peptide	A	S2 Q3 S4 E7	S3 Q4 S5 E8
BS05	peptide	A	Q3 E7 V10 S14 Y22 S23 W24 S25 Q26 M83 A84 K87 Q183 W188	Q4 E8 V11 S15 Y23 S24 W25 S26 Q27 M28 A29 K32 Q128 W133
BS06	BCT	A	D11 R91	D12 R36

Gene Ontology

	Biological Process
GO:0042981	regulation of apoptotic process

View graph for
Biological Process

External links

PDB	RCSB:4z9v, PDBe:4z9v, PDBj:4z9v
PDBsum	4z9v
PubMed	26813996
UniProt	Q07817\|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417