Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 4z4f Chain A

Receptor sequence >4z4fA (length=801) Species: 9606 (Homo sapiens) [Search protein sequence] AFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPCPRRVNRE IVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPIFK VSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGR SFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQP VIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEIKRKYRVCNVT RRPASHQTFPECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVC NIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSADFNTDPYV REFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHT GIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKY AQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMAT QCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFL GADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAA MVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKL EKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPT EFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCT RSVSIPAPAYYAHLVAFRARYHLVDKEGRDHQALAKAVQVHQDTLRTMYF A

3D structure PDB 4z4f Water-mediated recognition of t1-adenosine anchors Argonaute2 to microRNA targets. Chain A Resolution 2.8 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number 3.1.26.n2: argonaute-2.

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 rna A R68 R97 G178 R179 F294 Y311 H336 T337 I365 L522 G524 T526 Y529 K533 Q545 C546 Q548 N551 T559 N562 K566 K570 H600 A603 R635 E637 S672 Q675 K709 R710 H753 Q757 S760 R761 Y790 R792 C793 R795 S798 Y804 R45 R74 G149 R150 F259 Y267 H292 T293 I321 L478 G480 T482 Y485 K489 Q501 C502 Q504 N507 T515 N518 K522 K526 H556 A559 R591 E593 S628 Q631 K665 R666 H709 Q713 S716 R717 Y746 R748 C749 R751 S754 Y760 PDBbind-CN: Kd=0.45nM BS02 rna A D358 T361 S362 I365 R438 K525 Q558 S561 K726 F811 Y815 D314 T317 S318 I321 R394 K481 Q514 S517 K682 F767 Y771 PDBbind-CN: Kd=0.45nM BS03 MG A D597 V598 D553 V554

Gene Ontology Molecular Function GO:0000340 RNA 7-methylguanosine cap binding GO:0000993 RNA polymerase II complex binding GO:0001046 core promoter sequence-specific DNA binding GO:0003676 nucleic acid binding GO:0003723 RNA binding GO:0003725 double-stranded RNA binding GO:0003727 single-stranded RNA binding GO:0003729 mRNA binding GO:0003743 translation initiation factor activity GO:0004519 endonuclease activity GO:0004521 RNA endonuclease activity GO:0005515 protein binding GO:0016891 RNA endonuclease activity, producing 5'-phosphomonoesters GO:0035197 siRNA binding GO:0035198 miRNA binding GO:0035925 mRNA 3'-UTR AU-rich region binding GO:0046872 metal ion binding GO:0061980 regulatory RNA binding GO:0070551 endoribonuclease activity, cleaving siRNA-paired mRNA GO:0090624 endoribonuclease activity, cleaving miRNA-paired mRNA GO:0098808 mRNA cap binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006412	translation
GO:0006413	translational initiation
GO:0006417	regulation of translation
GO:0009791	post-embryonic development
GO:0010501	RNA secondary structure unwinding
GO:0010586	miRNA metabolic process
GO:0010628	positive regulation of gene expression
GO:0030422	siRNA processing
GO:0031047	regulatory ncRNA-mediated gene silencing
GO:0031054	pre-miRNA processing
GO:0033962	P-body assembly
GO:0035194	regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035196	miRNA processing
GO:0035278	miRNA-mediated gene silencing by inhibition of translation
GO:0035279	miRNA-mediated gene silencing by mRNA destabilization
GO:0042985	negative regulation of amyloid precursor protein biosynthetic process
GO:0045727	positive regulation of translation
GO:0045766	positive regulation of angiogenesis
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0045947	negative regulation of translational initiation
GO:0060213	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0070922	RISC complex assembly
GO:0090128	regulation of synapse maturation
GO:0090625	siRNA-mediated gene silencing by mRNA destabilization
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:1901165	positive regulation of trophoblast cell migration

	Cellular Component
GO:0000932	P-body
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016020	membrane
GO:0016442	RISC complex
GO:0030425	dendrite
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0043232	intracellular non-membrane-bounded organelle
GO:0070062	extracellular exosome
GO:0070578	RISC-loading complex
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse
GO:1990904	ribonucleoprotein complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component