Structure of PDB 7ymm Chain 2Z |
>7ymm2Z (length=59) Species: 329726 (Acaryochloris marina MBIC11017) [Search protein sequence] |
MSVLFQLLIAAFVALSFAMIIGVPVVFSTGDASDDANKLIWGGAAAWVVL LFVAALASI |
|
PDB | 7ymm Structure of a large photosystem II supercomplex from Acaryochloris marina. |
Chain | 2Z |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
2Z |
F17 I21 V25 |
F17 I21 V25 |
|
|
|
|