Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 8ucv Chain B Binding Site BS03

Receptor Information >8ucv Chain B (length=186) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] ISLEQIDGFAAKSFPLCMRQLHKSLRENHHLRHGGRMQYGLFLKGIGLTL EQALQFWRLEFTKGKVDSEKFDKVYAYSIRHNYGKEGKRTDYTPYSCMKV ILSNPPSQGDYHGCPFRHSDPELLKQKLQSFKVPSSGINQILELVKGMHY QLACQKYFELTHSVDDCGFSLNHPNQYFAESQKLLT

Ligand information Ligand ID SF4 InChI InChI=1S/4Fe.4S InChIKey LJBDFODJNLIPKO-UHFFFAOYSA-N SMILES Software SMILES OpenEye OEToolkits 2.0.7 [S]12[Fe]3[S]4[Fe]1[S]5[Fe]2[S]3[Fe]45 CACTVS 3.385 S1[Fe]S[Fe]1.S2[Fe]S[Fe]2 Formula Fe4 S4 Name IRON/SULFUR CLUSTER ChEMBL DrugBank ZINC PDB chain 8ucv Chain B Residue 601 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 8ucv A mechanistic model of primer synthesis from catalytic structures of DNA polymerase alpha-primase. Resolution 3.81 Å Binding residue (original residue number in PDB) P291 C293 C373 V376 C390 F392 C430 Binding residue (residue number reindexed from 1) P15 C17 C97 V100 C114 F116 C154 Annotation score 4

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003677 DNA binding GO:0046872 metal ion binding GO:0051539 4 iron, 4 sulfur cluster binding

	Biological Process
GO:0006260	DNA replication
GO:0006261	DNA-templated DNA replication
GO:0006269	DNA replication, synthesis of primer
GO:0006270	DNA replication initiation

	Cellular Component
GO:0005658	alpha DNA polymerase:primase complex
GO:1990077	primosome complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component