Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 2a8s Chain B Binding Site BS03

Receptor Information >2a8s Chain B (length=191) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] PRNISREESLQLEGYKHACHALLHAPSQAKLFDRVPIRRVLLMMMRFDGR LGFPGGFVDTRDISLEEGLKRELEEELGPALATVEVTEDDYRSSQVREHP QKCVTHFYIKELKLEEIERIEAEAVNAKDHGLEVMGLIRVPLYTLRDRVG GLPAFLCNNFIGNSKSQLLYALRSLKLLREDQIQEVLKASH

Ligand information Ligand ID MN InChI InChI=1S/Mn/q+2 InChIKey WAEMQWOKJMHJLA-UHFFFAOYSA-N SMILES Software SMILES ACDLabs 10.04 OpenEye OEToolkits 1.5.0 [Mn+2] CACTVS 3.341 [Mn++] Formula Mn Name MANGANESE (II) ION ChEMBL DrugBank DB06757 ZINC PDB chain 2a8s Chain B Residue 306 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 2a8s Crystal structures of U8 snoRNA decapping nudix hydrolase, X29, and its metal and cap complexes Resolution 2.45 Å Binding residue (original residue number in PDB) E92 D146 E150 Binding residue (residue number reindexed from 1) E75 D129 E133 Annotation score 1

Enzymatic activity Enzyme Commision number 3.6.1.62: 5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase. 3.6.1.64: inosine diphosphate phosphatase.

Gene Ontology Molecular Function GO:0000166 nucleotide binding GO:0000287 magnesium ion binding GO:0003723 RNA binding GO:0003729 mRNA binding GO:0008235 metalloexopeptidase activity GO:0016787 hydrolase activity GO:0030145 manganese ion binding GO:0030515 snoRNA binding GO:0035870 dITP diphosphatase activity GO:0042803 protein homodimerization activity GO:0046872 metal ion binding GO:0050897 cobalt ion binding GO:0097383 dIDP phosphatase activity GO:0110152 RNA NAD+-cap (NAD+-forming) hydrolase activity GO:0140933 5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase activity GO:1990003 IDP phosphatase activity GO:1990174 phosphodiesterase decapping endonuclease activity

	Biological Process
GO:0006402	mRNA catabolic process
GO:0009117	nucleotide metabolic process
GO:0016077	sno(s)RNA catabolic process
GO:0035863	dITP catabolic process
GO:0090068	positive regulation of cell cycle process
GO:0110155	NAD-cap decapping
GO:2000233	negative regulation of rRNA processing

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component