BioLiP

Structure of PDB 4csf Chain N Binding Site BS02

Receptor Information

>4csf Chain N (length=249) Species: 11590 (Toscana virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ENYRDIALAFLDESADSGTINAWVNEFAYQGFDPKRIVQLVKERGTAKGR
DWKKDVKMMIVLNLVRGNKPEAMMKKMSEKGASIVANLISVYQLKEGNPG
RDTITLSRVSAAFVPWTVQALRVLSESLPVSGTTMDAIAGVTYPRAMMHP
SFAGIIDLDLPNGAGATIADAHGLFMIEFSKTINPSLRTKQANEVAATFE
KPNMAAMSGRFFTREDKKKLLIAVGIIDEDLVLASAVVRSAEKYRAKVG

Ligand information

>4csf Chain o (length=9) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uguguuucu

.........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4csf Structural Insights Into RNA Encapsidation and Helical Assembly of the Toscana Virus Nucleoprotein.
Resolution	2.598 Å
Binding residue (original residue number in PDB)	K79 T185 I186
Binding residue (residue number reindexed from 1)	K76 T182 I183
Binding affinity	PDBbind-CN: Kd=260nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Cellular Component
GO:0019013	viral nucleocapsid
GO:0019029	helical viral capsid
GO:0030430	host cell cytoplasm
GO:0042025	host cell nucleus
GO:0044172	host cell endoplasmic reticulum-Golgi intermediate compartment
GO:0044177	host cell Golgi apparatus
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Cellular Component

PDB	RCSB:4csf, PDBe:4csf, PDBj:4csf
PDBsum	4csf
PubMed	24688060
UniProt	P21701\|NCAP_TOSV Nucleoprotein (Gene Name=N)