Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1is7 Chain N Binding Site BS02

Receptor Information >1is7 Chain N (length=84) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] MPYLLISTQIRMEVGPTMVGDEHSDPELMQQLGASKRRVLGNNFYEYYVN DPPRIVLDKLECRGFRVLSMTGVGQTLVWCLHKE

Ligand information Ligand ID PHE InChI InChI=1S/C9H11NO2/c10-8(9(11)12)6-7-4-2-1-3-5-7/h1-5,8H,6,10H2,(H,11,12)/t8-/m0/s1 InChIKey COLNVLDHVKWLRT-QMMMGPOBSA-N SMILES Software SMILES CACTVS 3.341 N[CH](Cc1ccccc1)C(O)=O CACTVS 3.341 N[C@@H](Cc1ccccc1)C(O)=O OpenEye OEToolkits 1.5.0 c1ccc(cc1)CC(C(=O)O)N OpenEye OEToolkits 1.5.0 c1ccc(cc1)C[C@@H](C(=O)O)N ACDLabs 10.04 O=C(O)C(N)Cc1ccccc1 Formula C9 H11 N O2 Name PHENYLALANINE ChEMBL CHEMBL301523 DrugBank DB00120 ZINC ZINC000000105196 PDB chain 1is7 Chain N Residue 1007 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1is7 Crystal structure of the stimulatory complex of GTP cyclohydrolase I and its feedback regulatory protein GFRP. Resolution 2.8 Å Binding residue (original residue number in PDB) I10 Q75 Binding residue (residue number reindexed from 1) I10 Q75 Annotation score 4

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0004857 enzyme inhibitor activity GO:0005515 protein binding GO:0016597 amino acid binding GO:0019899 enzyme binding GO:0030742 GTP-dependent protein binding GO:0042802 identical protein binding GO:0044549 GTP cyclohydrolase binding GO:0044877 protein-containing complex binding

	Biological Process
GO:0009890	negative regulation of biosynthetic process
GO:0045428	regulation of nitric oxide biosynthetic process
GO:0065003	protein-containing complex assembly

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016020	membrane
GO:0030425	dendrite
GO:0031965	nuclear membrane
GO:0032991	protein-containing complex
GO:0042470	melanosome

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component