Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 3mt6 Chain H Binding Site BS02

Receptor Information >3mt6 Chain H (length=186) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] ALVPMVIEERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENP EKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTA GAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAL HTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTH

Ligand information >3mt6 Chain n (length=7) Species: 67305 (Streptomyces hawaiiensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] tFSPAAK

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 3mt6 Acyldepsipeptide antibiotics induce the formation of a structured axial channel in ClpP: A model for the ClpX/ClpA-bound state of ClpP. Resolution 1.901 Å Binding residue (original residue number in PDB) L48 A52 T79 F82 Binding residue (residue number reindexed from 1) L43 A47 T74 F77

Enzymatic activity Catalytic site (original residue number in PDB) G68 S97 M98 H122 D171 Catalytic site (residue number reindexed from 1) G63 S92 M93 H117 D166 Enzyme Commision number 3.4.21.92: endopeptidase Clp.

Gene Ontology Molecular Function GO:0004176 ATP-dependent peptidase activity GO:0004252 serine-type endopeptidase activity GO:0005515 protein binding GO:0008236 serine-type peptidase activity GO:0042802 identical protein binding GO:0051117 ATPase binding

	Biological Process
GO:0006508	proteolysis
GO:0006515	protein quality control for misfolded or incompletely synthesized proteins
GO:0009266	response to temperature stimulus
GO:0009314	response to radiation
GO:0009408	response to heat
GO:0010498	proteasomal protein catabolic process
GO:0043068	positive regulation of programmed cell death

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0009368	endopeptidase Clp complex
GO:0009376	HslUV protease complex
GO:0016020	membrane

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component