Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 7ywx Chain G Binding Site BS02

Receptor Information >7ywx Chain G (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] KSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAV LLP

Ligand information >7ywx Chain J (length=162) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] ccgctttgaggccttcgttggaaacgggaatatgttcacataaaaactag acagaagcattctcagaaacttctatgtgatgtttgcattcaactcatag agttgaacattccttttcatagagcagttttgaaacactctttttgtagt atctggaattgg

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 7ywx Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome. Resolution 12.0 Å Binding residue (original residue number in PDB) K15 R17 R20 R29 R32 R77 Binding residue (residue number reindexed from 1) K1 R3 R6 R15 R18 R63

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003674 molecular_function GO:0003677 DNA binding GO:0005515 protein binding GO:0030527 structural constituent of chromatin GO:0031492 nucleosomal DNA binding GO:0046982 protein heterodimerization activity

	Biological Process
GO:0008285	negative regulation of cell population proliferation
GO:0031507	heterochromatin formation

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0070062	extracellular exosome

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component