Structure of PDB 5dy0 Chain C Binding Site BS02

Receptor Information

>5dy0 Chain C (length=218) Species: 1718 (Corynebacterium glutamicum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VGRPRRSAPRRAGKNPREEILDASAELFTHQGFATTSTHQIADAVGIRQA
SLYYHFPSKTEIFLTLLKSTVEPSTVLAEDLSILDAGPEMRLWAIVASEV
RLLLSTKWNVGRLYQLPIVGSEEFAEYHSQREALTNIFRDLATEIVGDDP
RAELPFHITMSVIEMRRNDGKIPSPLSADSLPETAIMLADASLAVLGASL
PADRVEKTLELIKQADAK

Ligand information

>5dy0 Chain H (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

attatctatagatctatagataatgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5dy0 Structure of AmtR, the global nitrogen regulator of Corynebacterium glutamicum, in free and DNA-bound forms.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	G6 R7 S41 T42 Q53 Y57 S62 K63
Binding residue (residue number reindexed from 1)	G2 R3 S37 T38 Q49 Y53 S58 K59

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3
Tue May 20 06:53:47 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

/var/www/html/BioLiP2/pdb.cgi in <module>()

1701 title=pdb2title(pdbid)

1702 if bs.startswith("BS"):

=> 1703 pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

1704 else:

1705 if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5dy0', asym_id = 'C', bs = 'BS02', title = 'Structure of AmtR, the global nitrogen regulator...acterium glutamicum, in free and DNA-bound forms.'

/var/www/html/BioLiP2/pdb.cgi in display_interaction(pdbid='5dy0', asym_id='C', bs='BS02', title='Structure of AmtR, the global nitrogen regulator...acterium glutamicum, in free and DNA-bound forms.')

1326 display_ec(ec,csaOrig,csaRenu)

1327 if go:

=> 1328 display_go(go,uniprot,pdbid,asym_id)

1329 return pubmed,uniprot

1330

global display_go = <function display_go>, go = '0003677', uniprot = '', pdbid = '5dy0', asym_id = 'C'

/var/www/html/BioLiP2/pdb.cgi in display_go(go='0003677', uniprot='', pdbid='5dy0', asym_id='C')

484 '''.replace("$namespace_link",namespace_link

485 ).replace("$namespace",namespace

=> 486 ).replace("$uniprot",u

487 ))

488 for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
args = ("local variable 'u' referenced before assignment",)
with_traceback = <built-in method with_traceback of UnboundLocalError object>