Structure of PDB 4bhk Chain B Binding Site BS02

Receptor Information

>4bhk Chain B (length=158) Species: 3218 (Physcomitrium patens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PREHPFIVTEPGEPAKGKKNGLDYLFDLYEQCGKFLEEVQHIAKEKGEKC
PSKVTNEVFRHAKLTGAGYINKPKMRDYVHCYALHCLDVETSNNLRKEYK
ERGENVGAWCQACYFPLVKLARQNEWDIDDLFNRNDKLRIWYVPTKLRQL
CHIERMKH

Ligand information

>4bhk Chain X (length=29) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtgctcaccgtccgctggtcgcccgtggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4bhk A Promiscuous Intermediate Underlies the Evolution of Leafy DNA Binding Specificity.
Resolution	2.32 Å
Binding residue (original residue number in PDB)	R190 H192 K206 T243 N244 R248 K260 R264 Y330 T333
Binding residue (residue number reindexed from 1)	R2 H4 K18 T55 N56 R60 K72 R76 Y142 T145

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4bhk, PDBe:4bhk, PDBj:4bhk
PDBsum	4bhk
PubMed	24436181
UniProt	Q94IF5

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417