Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1u0d Chain B Binding Site BS02

Receptor Information >1u0d Chain B (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSHKFKHQLSLTFQVTEKTQR RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV LD

Ligand information >1u0d Chain D (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] cggaactgtctcacgacgtttcgc

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1u0d Isolation and characterization of new homing endonuclease specificities at individual target site positions. Resolution 2.9 Å Binding residue (original residue number in PDB) D320 S322 I324 Q326 K328 Q344 T346 E347 K348 R370 V373 N436 D437 S438 K442 Binding residue (residue number reindexed from 1) D19 S21 I23 Q25 K27 Q43 T45 E46 K47 R69 V72 N135 D136 S137 K141 Binding affinity PDBbind-CN: Kd=2.0nM

Enzymatic activity Catalytic site (original residue number in PDB) G319 D320 Catalytic site (residue number reindexed from 1) G18 D19 Enzyme Commision number 3.1.-.-

Gene Ontology Molecular Function GO:0004519 endonuclease activity GO:0042802 identical protein binding GO:0046872 metal ion binding

	Biological Process
GO:0006314	intron homing

	Cellular Component
GO:0009507	chloroplast

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component