Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1gt1 Chain B Binding Site BS02

Receptor Information >1gt1 Chain B (length=155) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] EEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTV DFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAH NINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLEN ENHPH

Ligand information Ligand ID 3OM InChI InChI=1S/C8H16O/c1-3-5-6-7-8(9)4-2/h4,8-9H,2-3,5-7H2,1H3/t8-/m1/s1 InChIKey VSMOENVRRABVKN-MRVPVSSYSA-N SMILES Software SMILES OpenEye OEToolkits 1.7.6 CCCCC[C@@H](C=C)O CACTVS 3.385 CCCCC[CH](O)C=C ACDLabs 12.01 OC(/C=C)CCCCC CACTVS 3.385 CCCCC[C@H](O)C=C OpenEye OEToolkits 1.7.6 CCCCCC(C=C)O Formula C8 H16 O Name (3S)-1-octen-3-ol ChEMBL DrugBank DB03025 ZINC ZINC000002026960 PDB chain 1gt1 Chain B Residue 1159 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1gt1 Crystal Structures of Bovine Odorant-Binding Protein in Complex with Odorant Molecules. Resolution 1.71 Å Binding residue (original residue number in PDB) I22 F36 T38 N87 N103 Binding residue (residue number reindexed from 1) I20 F34 T36 N85 N101 Annotation score 1 Binding affinity MOAD: Kd=1.2uM

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0005549 odorant binding GO:0036094 small molecule binding

	Biological Process
GO:0007608	sensory perception of smell

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component