Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1a4f Chain B Binding Site BS02

Receptor Information >1a4f Chain B (length=146) Species: 8846 (Anser indicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] VHWSAEEKQLITGLWGKVNVADCGAEALARLLIVYPWTQRFFSSFGNLSS PTAILGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDP ENFRLLGDILIIVLAAHFAKEFTPDCQAAWQKLVRVVAHALARKYH

Ligand information Ligand ID OXY InChI InChI=1S/O2/c1-2 InChIKey MYMOFIZGZYHOMD-UHFFFAOYSA-N SMILES Software SMILES CACTVS 3.341 OpenEye OEToolkits 1.5.0 O=O Formula O2 Name OXYGEN MOLECULE ChEMBL CHEMBL1234886 DrugBank DB09140 ZINC PDB chain 1a4f Chain B Residue 151 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1a4f The crystal structure of a high oxygen affinity species of haemoglobin (bar-headed goose haemoglobin in the oxy form). Resolution 2.0 Å Binding residue (original residue number in PDB) H63 V67 Binding residue (residue number reindexed from 1) H63 V67 Annotation score 4

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0004601 peroxidase activity GO:0005344 oxygen carrier activity GO:0019825 oxygen binding GO:0020037 heme binding GO:0031720 haptoglobin binding GO:0043177 organic acid binding GO:0046872 metal ion binding

	Biological Process
GO:0015671	oxygen transport
GO:0042744	hydrogen peroxide catabolic process
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005833	hemoglobin complex
GO:0031838	haptoglobin-hemoglobin complex
GO:0072562	blood microparticle

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component