Structure of PDB 2kae Chain A Binding Site BS02

Receptor Information

>2kae Chain A (length=56) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQK
RKLKVQ

Ligand information

>2kae Chain B (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cggaaaagtatacttttccg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2kae Structural Analysis of MED-1 Reveals Unexpected Diversity in the Mechanism of DNA Recognition by GATA-type Zinc Finger Domains.
Resolution	N/A
Binding residue (original residue number in PDB)	R124 W125 R126 N127 I128 I141 R144 T153 A154 N156 K157 Y158 K160 R161
Binding residue (residue number reindexed from 1)	R14 W15 R16 N17 I18 I31 R34 T43 A44 N46 K47 Y48 K50 R51
Binding affinity	PDBbind-CN: Kd=8nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3
Wed May 21 02:56:43 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

/var/www/html/BioLiP2/pdb.cgi in <module>()

1701 title=pdb2title(pdbid)

1702 if bs.startswith("BS"):

=> 1703 pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

1704 else:

1705 if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '2kae', asym_id = 'A', bs = 'BS02', title = 'Structural Analysis of MED-1 Reveals Unexpected ...DNA Recognition by GATA-type Zinc Finger Domains.'

/var/www/html/BioLiP2/pdb.cgi in display_interaction(pdbid='2kae', asym_id='A', bs='BS02', title='Structural Analysis of MED-1 Reveals Unexpected ...DNA Recognition by GATA-type Zinc Finger Domains.')

1326 display_ec(ec,csaOrig,csaRenu)

1327 if go:

=> 1328 display_go(go,uniprot,pdbid,asym_id)

1329 return pubmed,uniprot

1330

global display_go = <function display_go>, go = '0006355,0008270,0043565', uniprot = '', pdbid = '2kae', asym_id = 'A'

/var/www/html/BioLiP2/pdb.cgi in display_go(go='0006355,0008270,0043565', uniprot='', pdbid='2kae', asym_id='A')

484 '''.replace("$namespace_link",namespace_link

485 ).replace("$namespace",namespace

=> 486 ).replace("$uniprot",u

487 ))

488 for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
args = ("local variable 'u' referenced before assignment",)
with_traceback = <built-in method with_traceback of UnboundLocalError object>