Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1o2e Chain A Binding Site BS02

Receptor Information >1o2e Chain A (length=123) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] ALWQFNGMIKCKIPSSEPLLDFNNYGCYCGLGGSGTPVDDLDRCCQTHDN CYMQAMKLDSCKVLVDNPYTNNYSYSCSNNEITCSSENNACEAFICNCDR NAAICFSKVPYNKEHKNLDMKNC

Ligand information Ligand ID ANN InChI InChI=1S/C8H8O3/c1-11-7-4-2-6(3-5-7)8(9)10/h2-5H,1H3,(H,9,10) InChIKey ZEYHEAKUIGZSGI-UHFFFAOYSA-N SMILES Software SMILES CACTVS 3.341 COc1ccc(cc1)C(O)=O OpenEye OEToolkits 1.5.0 COc1ccc(cc1)C(=O)O ACDLabs 10.04 O=C(O)c1ccc(OC)cc1 Formula C8 H8 O3 Name 4-METHOXYBENZOIC ACID; P-ANISIC ACID ChEMBL CHEMBL21932 DrugBank DB02795 ZINC ZINC000000332748 PDB chain 1o2e Chain A Residue 401 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1o2e Crystal structures of the free and anisic acid bound triple mutant of phospholipase A2. Resolution 2.6 Å Binding residue (original residue number in PDB) F5 P18 L19 G30 Binding residue (residue number reindexed from 1) F5 P18 L19 G30 Annotation score 1

Enzymatic activity Catalytic site (original residue number in PDB) Y28 G30 G32 H48 D49 Y52 Y73 D99 Catalytic site (residue number reindexed from 1) Y28 G30 G32 H48 D49 Y52 Y73 D99 Enzyme Commision number 3.1.1.4: phospholipase A2.

Gene Ontology Molecular Function GO:0004623 phospholipase A2 activity GO:0005102 signaling receptor binding GO:0005509 calcium ion binding GO:0005543 phospholipid binding GO:0016787 hydrolase activity GO:0032052 bile acid binding GO:0046872 metal ion binding GO:0047498 calcium-dependent phospholipase A2 activity

	Biological Process
GO:0002227	innate immune response in mucosa
GO:0006629	lipid metabolic process
GO:0006633	fatty acid biosynthetic process
GO:0006644	phospholipid metabolic process
GO:0008284	positive regulation of cell population proliferation
GO:0016042	lipid catabolic process
GO:0019731	antibacterial humoral response
GO:0046470	phosphatidylcholine metabolic process
GO:0046471	phosphatidylglycerol metabolic process
GO:0048146	positive regulation of fibroblast proliferation
GO:0050482	arachidonate secretion
GO:0050830	defense response to Gram-positive bacterium
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:1904635	positive regulation of podocyte apoptotic process

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0009986	cell surface

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component