BioLiP

Structure of PDB 8pdn Chain G Binding Site BS01

Receptor Information

>8pdn Chain G (length=339) Species: 694067 (Human metapneumovirus CAN97-83) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DLSYKHAILKESQYTIKRDVGTTTAVTPSSLQQEITLLCGEILYAKHADY
KYAAEIGIQYISTALGSERVQQILRNSGSEVQVVLTRTYSQMLDIHGVEK
SWVEEIDKEARKTMATLLKESSGNIPQNQRPSAPDTPIILLCVGALIFTK
LASTIEVGLETTVRRANRVLSDALKRYPRMDIPKIARSFYDLFEQKVYHR
SLFIEYGKALGSSSTGSKAESLFVNIFMQAYGAGQTMLRWGVIARSSNNI
MLGHVSVQAELKQVTEVYDLVREMGPESGLLHLRQSPKAGLLSLANCPNF
ASVVLGNASGLGIIGMYRGRVPNTELFSAAESYAKSLKE

Ligand information

>8pdn Chain g (length=7) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccccccc

.......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pdn Structure of the N-RNA/P interface indicates mode of L/P recruitment to the nucleocapsid of human metapneumovirus.
Resolution	4.7 Å
Binding residue (original residue number in PDB)	K171 A173 S174 R185 R186 R189 Q250 G255 T257 W261 S314 I334 M337 Y338 R339
Binding residue (residue number reindexed from 1)	K150 A152 S153 R164 R165 R168 Q229 G234 T236 W240 S293 I313 M316 Y317 R318

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Cellular Component
GO:0019013	viral nucleocapsid
GO:0019029	helical viral capsid
GO:0030430	host cell cytoplasm
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Cellular Component

PDB	RCSB:8pdn, PDBe:8pdn, PDBj:8pdn
PDBsum	8pdn
PubMed	37993464
UniProt	Q6WBA1\|NCAP_HMPVC Nucleoprotein (Gene Name=N)