Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 4b09 Chain C Binding Site BS01

Receptor Information >4b09 Chain C (length=218) Species: 511145 (Escherichia coli str. K-12 substr. MG1655) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] NTPRILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLI LLDLMLPGTDGLMLCREIRRFSDIPIVMVTAKIEEIDRLLGLEIGADDYI CKPYSPREVVARVKTILRSPLIIDEGRFQASWRGKMLDLTPAEFRLLKTL SHEPGKVFSREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLESLDAEQSFI RAVYGVGYRWEADACRIV

Ligand information Ligand ID TBR InChI InChI=1S/12BrH.6Ta/h12*1H;;;;;;/q;;;;;;;;;;;;;;;;;+1/p-1 InChIKey YWYIQTPPCOBSGN-UHFFFAOYSA-M SMILES Software SMILES OpenEye OEToolkits 1.7.0 Br[Ta]123456Br[Ta]17891%10[Ta]22%11(Br7)[Ta]337%12%13([Ta]484([Ta]923(Br%11)(Br1)(Br4)(Br7)Br%12)(Br5)(Br%10)Br%13)Br6 CACTVS 3.370 Br|1[Ta]|2|3|4|5|Br[Ta]|6|7|89%10|2|Br[Ta]|%11|%12|%13|%14|1|3|6Br|[Ta]|%15|%16|%17|7|%11(Br|[Ta]|%18|4|%12|%15(Br|%13)(Br|%14)|Br[Ta]|5|8|%16|%18(|Br9)(Br)Br|%17)|Br%10 Formula Br12 Ta6 Name HEXATANTALUM DODECABROMIDE; DODECABROMOHEXATANTALUM ChEMBL DrugBank DB04119 ZINC PDB chain 4b09 Chain C Residue 1241 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 4b09 The Dimeric Form of the Unphosphorylated Response Regulator Baer. Resolution 3.3 Å Binding residue (original residue number in PDB) G43 D44 D68 M71 L72 E75 Binding residue (residue number reindexed from 1) G35 D36 D60 M63 L64 E67 Annotation score 1

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0000156 phosphorelay response regulator activity GO:0000976 transcription cis-regulatory region binding GO:0003677 DNA binding

	Biological Process
GO:0000160	phosphorelay signal transduction system
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0032993	protein-DNA complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component