Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 2mfg Chain C Binding Site BS01

Receptor Information >2mfg Chain C (length=59) Species: 294 (Pseudomonas fluorescens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQR IQAGLTAPD

Ligand information >2mfg Chain B (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] gggucaucaggacgaugaccc <<<<<<<<.....>>>>>>>>

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 2mfg Molecular basis for the wide range of affinity found in Csr/Rsm protein-RNA recognition. Resolution N/A Binding residue (original residue number in PDB) L23 G27 Q29 R31 A36 P37 K38 A41 V42 H43 R44 Binding residue (residue number reindexed from 1) L23 G27 Q29 R31 A36 P37 K38 A41 V42 H43 R44 Binding affinity PDBbind-CN: Kd=2.9uM

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003723 RNA binding GO:0048027 mRNA 5'-UTR binding

	Biological Process
GO:0006109	regulation of carbohydrate metabolic process
GO:0006402	mRNA catabolic process
GO:0006417	regulation of translation
GO:0045947	negative regulation of translational initiation
GO:0045948	positive regulation of translational initiation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component