Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 4en2 Chain B Binding Site BS01

Receptor Information >4en2 Chain B (length=149) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] SKSSVIGWPAVRERMRRAEPAEEVGFPVTPQVPLRPMTYKAAVDLSHFLK EKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFGWC YKLVPVEPDKVEEANKGENDPEREVLEWRFDSRLAFHHVARELHPEYFK

Ligand information >4en2 Chain E (length=18) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] DRKGGSYSQAAGSDSAQG

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 4en2 Structural basis of evasion of cellular adaptive immunity by HIV-1 Nef. Resolution 2.58 Å Binding residue (original residue number in PDB) Q73 P75 P78 M79 T80 T138 F203 Binding residue (residue number reindexed from 1) Q31 P33 P36 M37 T38 T96 F148

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0005102 signaling receptor binding GO:0005515 protein binding GO:0005525 GTP binding GO:0017124 SH3 domain binding GO:0019901 protein kinase binding GO:0031996 thioesterase binding GO:0042288 MHC class I protein binding GO:0042609 CD4 receptor binding GO:0051117 ATPase binding

	Biological Process
GO:0006915	apoptotic process
GO:0019049	virus-mediated perturbation of host defense response
GO:0019058	viral life cycle
GO:0033668	symbiont-mediated suppression of host apoptosis
GO:0039505	symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class II
GO:0039521	suppression by virus of host autophagy
GO:0045225	negative regulation of CD4 production
GO:0046776	symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class I
GO:0050848	regulation of calcium-mediated signaling
GO:0070206	protein trimerization
GO:0075528	perturbation by virus of host immune response

	Cellular Component
GO:0005576	extracellular region
GO:0016020	membrane
GO:0020002	host cell plasma membrane
GO:0044177	host cell Golgi apparatus
GO:0044178	host cell Golgi membrane
GO:0044423	virion component

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component