BioLiP

Structure of PDB 2rfi Chain B Binding Site BS01

Receptor Information

>2rfi Chain B (length=252) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITH
LQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHA
CSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGE
LISDSEADVREEDSYLFDLVYCIDARFYGNVSRFINHHCEPNLVPVRVFM
AHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCR
HS

Ligand information

>2rfi Chain Q (length=6) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TARKST

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2rfi Structural biology of human H3K9 methyltransferases
Resolution	1.59 Å
Binding residue (original residue number in PDB)	Y1124 D1131 A1134 D1135 D1140 S1141 Y1142 L1143 F1144 D1145 Y1211 R1214 F1215
Binding residue (residue number reindexed from 1)	Y147 D154 A157 D158 D163 S164 Y165 L166 F167 D168 Y228 R231 F232

Enzymatic activity

Catalytic site (original residue number in PDB)	Y1124 Y1211
Catalytic site (residue number reindexed from 1)	Y147 Y228
Enzyme Commision number	2.1.1.- 2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Gene Ontology

	Molecular Function
GO:0002039	p53 binding
GO:0008270	zinc ion binding
GO:0016279	protein-lysine N-methyltransferase activity
GO:0042054	histone methyltransferase activity
GO:0046974	histone H3K9 methyltransferase activity

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Cellular Component

PDB	RCSB:2rfi, PDBe:2rfi, PDBj:2rfi
PDBsum	2rfi
PubMed	20084102
UniProt	Q9H9B1\|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 (Gene Name=EHMT1)