Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1owf Chain B Binding Site BS01

Receptor Information >1owf Chain B (length=94) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIAIRGFGS FSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

Ligand information >1owf Chain C (length=35) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] cggtgcaacaaattgataagcaatgcttttttggc

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1owf Integration Host Factor: putting a twist on protein-DNA recognition Resolution 1.95 Å Binding residue (original residue number in PDB) S4 R42 R46 S50 R59 R62 N63 P64 L72 K75 K81 G83 K84 Binding residue (residue number reindexed from 1) S4 R42 R46 S50 R59 R62 N63 P64 L72 K75 K81 G83 K84 Binding affinity PDBbind-CN: Kd=4.6nM

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003677 DNA binding GO:0030527 structural constituent of chromatin GO:0043565 sequence-specific DNA binding

	Biological Process
GO:0006310	DNA recombination
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription
GO:0006417	regulation of translation

	Cellular Component
GO:0005694	chromosome
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:1990177	IHF-DNA complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component