BioLiP

Structure of PDB 7t8y Chain A Binding Site BS01

Receptor Information

>7t8y Chain A (length=158) Species: 1314 (Streptococcus pyogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LPVIGGIAIPELGINLPIFKGLGNTELIYGAGTMKEEQVMGGENNYSLAS
HHIFGITGSSQMLFSPLERAQNGMSIYLTDKEKIYEYIIKDVFTVAPERV
DVIDDTAGLKEVTLVTCTDIEATERIIVKGELKTEYDFDKAPADVLKAFN
HSYNQVST

Ligand information

>7t8y Chain B (length=7) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gLPATAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7t8y Structures of Streptococcus pyogenes class A sortase in complex with substrate and product mimics provide key details of target recognition.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	M125 S141 H142 H143 I144 P188 R190 V191 T207 C208 I211 R216
Binding residue (residue number reindexed from 1)	M34 S50 H51 H52 I53 P97 R99 V100 T116 C117 I120 R125

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:7t8y, PDBe:7t8y, PDBj:7t8y
PDBsum	7t8y
PubMed	36055407
UniProt	Q99ZN4

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417