Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 7s3b Chain A Binding Site BS01

Receptor Information >7s3b Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQ INQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPENPSVY VPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSA TGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAK

Ligand information >7s3b Chain B (length=8) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] uuuguucc ........

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 7s3b Pre-mRNA splicing factor U2AF2 recognizes distinct conformations of nucleotide variants at the center of the pre-mRNA splice site signal. Resolution 1.89 Å Binding residue (original residue number in PDB) R146 R150 Y152 K195 F197 F199 R227 P229 H230 D231 T252 V254 K260 F262 G264 G265 N289 S294 G297 Y302 F304 K329 A335 G338 A339 K340 Binding residue (residue number reindexed from 1) R6 R10 Y12 K55 F57 F59 R87 P89 H90 D91 T107 V109 K115 F117 G119 G120 N144 S149 G152 Y157 F159 K184 A190 G193 A194 K195

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003676 nucleic acid binding GO:0003723 RNA binding

	Biological Process
GO:0006397	mRNA processing

	Cellular Component
GO:0005634	nucleus

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component