Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 7l3d Chain A Binding Site BS01

Receptor Information >7l3d Chain A (length=162) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAI GRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCAAI NMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVI TTFRTGTWDAYK

Ligand information Ligand ID XQJ InChI InChI=1S/C7H7I/c1-6-3-2-4-7(8)5-6/h2-5H,1H3 InChIKey VLCPISYURGTGLP-UHFFFAOYSA-N SMILES Software SMILES OpenEye OEToolkits 2.0.7 Cc1cccc(c1)I ACDLabs 12.01 Cc1cc(ccc1)I CACTVS 3.385 Cc1cccc(I)c1 Formula C7 H7 I Name 1-iodo-3-methylbenzene; 3-iodotoluene ChEMBL DrugBank ZINC ZINC000001672847 PDB chain 7l3d Chain A Residue 205 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 7l3d Temperature artifacts in protein structures bias ligand-binding predictions. Resolution 1.35 Å Binding residue (original residue number in PDB) V87 Y88 A99 M102 L118 Binding residue (residue number reindexed from 1) V87 Y88 A99 M102 L118 Annotation score 1

Enzymatic activity Enzyme Commision number 3.2.1.17: lysozyme.

Gene Ontology Molecular Function GO:0003796 lysozyme activity GO:0016798 hydrolase activity, acting on glycosyl bonds

	Biological Process
GO:0009253	peptidoglycan catabolic process
GO:0016998	cell wall macromolecule catabolic process
GO:0031640	killing of cells of another organism
GO:0042742	defense response to bacterium
GO:0044659	viral release from host cell by cytolysis

	Cellular Component
GO:0030430	host cell cytoplasm

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component