Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 6pgy Chain A Binding Site BS01

Receptor Information >6pgy Chain A (length=162) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAI GRNTNGVITKDEAECLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALI NMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVI TTFRTGTWDAYK

Ligand information Ligand ID MTN InChI InChI=1S/C10H19NO3S2/c1-9(2)6-8(7-15-16(5,13)14)10(3,4)11(9)12/h6,12H,7H2,1-5H3 InChIKey MXZPGYFBZHBAQM-UHFFFAOYSA-N SMILES Software SMILES CACTVS 3.370 CC1(C)C=C(CS[S](C)(=O)=O)C(C)(C)N1[O] OpenEye OEToolkits 1.7.2 CC1(C=C(C(N1[O])(C)C)CSS(=O)(=O)C)C ACDLabs 12.01 ON1C(C=C(CSS(=O)(=O)C)C1(C)C)(C)C Formula C10 H18 N O3 S2 Name S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate; MTSL ChEMBL DrugBank DB08217 ZINC ZINC000002569540 PDB chain 6pgy Chain A Residue 203 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 6pgy Making hydrogens stand out: Enhanced neutron diffraction from biological crystals using dynamic nuclear polarization Resolution 2.0 Å Binding residue (original residue number in PDB) D61 C65 Binding residue (residue number reindexed from 1) D61 C65 Annotation score 1

Enzymatic activity Enzyme Commision number 3.2.1.17: lysozyme.

Gene Ontology Molecular Function GO:0003796 lysozyme activity GO:0016798 hydrolase activity, acting on glycosyl bonds

	Biological Process
GO:0009253	peptidoglycan catabolic process
GO:0016998	cell wall macromolecule catabolic process
GO:0031640	killing of cells of another organism
GO:0042742	defense response to bacterium
GO:0044659	viral release from host cell by cytolysis

	Cellular Component
GO:0030430	host cell cytoplasm

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component