Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 6o8q Chain A Binding Site BS01

Receptor Information >6o8q Chain A (length=75) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] GMNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGT FKVNHRAAANVPAFVSGKALKDAVK

Ligand information >6o8q Chain L (length=57) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] aatttcaattatccccttaaaattttataaccatataaataaaaatatct aaccccc

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 6o8q Nucleoid remodeling during environmental adaptation is regulated by HU-dependent DNA bundling. Resolution 3.216 Å Binding residue (original residue number in PDB) V45 G46 K83 Binding residue (residue number reindexed from 1) V46 G47 K68

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003677 DNA binding GO:0005515 protein binding GO:0030527 structural constituent of chromatin GO:0042802 identical protein binding

	Biological Process
GO:0006270	DNA replication initiation
GO:0006281	DNA repair
GO:0006351	DNA-templated transcription
GO:0006974	DNA damage response
GO:0030261	chromosome condensation
GO:0036386	bacterial nucleoid packaging

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0009295	nucleoid
GO:0016020	membrane
GO:1990103	DnaA-HU complex
GO:1990178	HU-DNA complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component