Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 4x3h Chain A Binding Site BS01

Receptor Information
>4x3h Chain A (length=79) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSPEFPGLDTQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNG
PAKKWWEFKQGSVKNWVEFKKEFLQYSEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x3h Structural basis of arc binding to synaptic proteins: implications for cognitive disease.
Resolution2.401 Å
Binding residue
(original residue number in PDB)		F206 D210 T211 Q212 I213 F214 E215 F220 H223 L224 H245 N247 F271 Y274
Binding residue
(residue number reindexed from 1)		F8 D12 T13 Q14 I15 F16 E17 F22 H25 L26 H47 N49 F73 Y76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0050804 modulation of chemical synaptic transmission
GO:2000969 positive regulation of AMPA receptor activity

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4x3h, PDBe:4x3h, PDBj:4x3h
PDBsum4x3h
PubMed25864631
UniProtQ63053|ARC_RAT Activity-regulated cytoskeleton-associated protein (Gene Name=Arc)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417