Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 2iif Chain A Binding Site BS01

Receptor Information >2iif Chain A (length=204) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] MASTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGGSGGLTKA EMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVELSGFGNFDLRD KNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENAGGGERIEIRGFG SFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYGGSGHH HHHH

Ligand information >2iif Chain C (length=35) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] cggtgcaacaaattgataagcaatgcttttttggc

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 2iif A Divalent Metal-mediated Switch Controlling Protein-induced DNA Bending Resolution 2.72 Å Binding residue (original residue number in PDB) K5 S6 R99 K101 P105 R107 P109 K110 R126 K132 R143 E145 R147 G148 S151 R163 N164 P165 L173 K176 G184 K185 Binding residue (residue number reindexed from 1) K5 S6 R99 K101 P105 R107 P109 K110 R126 K132 R143 E145 R147 G148 S151 R163 N164 P165 L173 K176 G184 K185

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0000976 transcription cis-regulatory region binding GO:0001216 DNA-binding transcription activator activity GO:0003677 DNA binding GO:0030527 structural constituent of chromatin GO:0043565 sequence-specific DNA binding

	Biological Process
GO:0006310	DNA recombination
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription
GO:0006417	regulation of translation
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0009295	nucleoid
GO:0032993	protein-DNA complex
GO:1990177	IHF-DNA complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component