Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1hoy Chain A Binding Site BS01

Receptor Information >1hoy Chain A (length=74) Species: 8616 (Bungarus multicinctus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPS KKPYEEVTCCSTDKCNPHPKQRPG

Ligand information >1hoy Chain B (length=14) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] HRYYESSLEPWYPD

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1hoy NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor. Resolution N/A Binding residue (original residue number in PDB) T6 P10 I11 D30 C33 S34 R36 G37 K38 V40 H68 P69 K70 Q71 Binding residue (residue number reindexed from 1) T6 P10 I11 D30 C33 S34 R36 G37 K38 V40 H68 P69 K70 Q71

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0005515 protein binding GO:0030550 acetylcholine receptor inhibitor activity GO:0090729 toxin activity GO:0099106 ion channel regulator activity

	Biological Process
GO:0035821	modulation of process of another organism

	Cellular Component
GO:0005576	extracellular region

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component