BioLiP

Structure of PDB 7pjy Chain g

Receptor sequence

>7pjyg (length=151) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
A

3D structure

PDB

7pjy Structural mechanism of GTPase-powered ribosome-tRNA movement.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g	P1 R2 R3 R4 V5 I6 R9 K24 N27 D32 G33 K34 K35 S36 R78 R91 R94 R108 D112 K113 M115 R118	P1 R2 R3 R4 V5 I6 R9 K24 N27 D32 G33 K34 K35 S36 R78 R91 R94 R108 D112 K113 M115 R118

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:7pjy, PDBe:7pjy, PDBj:7pjy
PDBsum	7pjy
PubMed	34635670
UniProt	P02359\|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)