BioLiP

Structure of PDB 8f4c Chain c

Receptor sequence

>8f4cc (length=451) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFEL
AHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISS
AVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGA
LLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEG
WIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYL
SYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQ
KLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGP
NGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSP
RSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSL
D

3D structure

PDB

8f4c Structural evidence for intermediates during O 2 formation in photosystem II.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	OEY	c	E354 R357	E332 R335
BS02	OEX	c	E354 R357	E332 R335
BS03	CLA	c	A172 L175 H237 I240 F289 Y297	A150 L153 H215 I218 F267 Y275
BS04	CLA	c	W63 H91 F182 L279 M282 A286 Y297 H430 L433 F437	W41 H69 F160 L257 M260 A264 Y275 H408 L411 F415
BS05	CLA	c	I60 V61 L88 H91 H118	I38 V39 L66 H69 H96
BS06	CLA	c	W63 M67 F70 G85 I87 W425 S429	W41 M45 F48 G63 I65 W403 S407
BS07	CLA	c	Y274 H441 L442 A445 R449	Y252 H419 L420 A423 R427
BS08	CLA	c	L165 I243 G247 W250 H251 T255 P256 F257 W259 F264	L143 I221 G225 W228 H229 T233 P234 F235 W237 F242
BS09	CLA	c	M157 L161 H164 L168 W266 Y271 Y274 S275	M135 L139 H142 L146 W244 Y249 Y252 S253
BS10	CLA	c	W36 A37 N39 L272 L276 F436 F437 G440 W443 H444 R447	W14 A15 N17 L250 L254 F414 F415 G418 W421 H422 R425
BS11	CLA	c	N39 I43 L49 A52 H53 H56 Y149 W151 G268 E269 Y271 L272 S275	N17 I21 L27 A30 H31 H34 Y127 W129 G246 E247 Y249 L250 S253
BS12	CLA	c	H56 I60 W63 F437	H34 I38 W41 F415
BS13	CLA	c	R26 W35 G38 N39 R41 L42 K48 A52 F127 I134	R4 W13 G16 N17 R19 L20 K26 A30 F105 I112
BS14	CLA	c	H53 F146 F147 I160 F163 H164 V167 I170	H31 F124 F125 I138 F141 H142 V145 I148
BS15	CLA	c	L50 V124 G128 Y131 H132 Y143 F147	L28 V102 G106 Y109 H110 Y121 F125

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009767	photosynthetic electron transport chain
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005737	cytoplasm
GO:0009521	photosystem
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:8f4c, PDBe:8f4c, PDBj:8f4c
PDBsum	8f4c
PubMed	37138085
UniProt	Q8DIF8\|PSBC_THEVB Photosystem II CP43 reaction center protein (Gene Name=psbC)