BioLiP

Structure of PDB 5nwy Chain V

Receptor sequence

>5nwyV (length=141) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEK
GLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKI
SRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED

3D structure

PDB

5nwy The force-sensing peptide VemP employs extreme compaction and secondary structure formation to induce ribosomal stalling.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	V5 V9 K10 P23 V24 Q30 Q31 P54 P75 A76 A77 V78 K81 S90 G91 K92 P93 N94 D116 M117 T118 G119 A124 R127 S128 G131 T132 R134 S135 M136	V4 V8 K9 P22 V23 Q29 Q30 P53 P74 A75 A76 V77 K80 S89 G90 K91 P92 N93 D115 M116 T117 G118 A123 R126 S127 G130 T131 R133 S134 M135

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination
GO:0015968	stringent response

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:5nwy, PDBe:5nwy, PDBj:5nwy
PDBsum	5nwy
PubMed	28556777
UniProt	P0A7J7\|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)