BioLiP

Structure of PDB 3jam Chain T

Receptor sequence

>3jamT (length=143) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

PGVSVRDVPAQDFINNYASFLQRQGKLEVPGYVDIVKTSAGNELPPQDSE
GWFYKRAASVARHIYLRKQVGVGKLNKLYGGAKNRGVRPHKHVDASGSIN
RKVLQSLEKLGVVEISPKGGRRISDNGLRDLDRIAAATLEDEE

3D structure

PDB

3jam Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.

Chain

Resolution

3.46 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	P2 G3 V4 R7 Q12 I15 Y33 V37 T39 A41 N43 E44 L45 P47 Q48 W53 R57 S60 H64 R68 K69 G72 V73 G74 K75 K78 L79 K84 N85 R86 G87 V88 R89 P90 H91 K92 H93 S99 R102 Q106 K119 G120 G121 R122 D126 R130 D133	P1 G2 V3 R6 Q11 I14 Y32 V36 T38 A40 N42 E43 L44 P46 Q47 W52 R56 S59 H63 R67 K68 G71 V72 G73 K74 K77 L78 K83 N84 R85 G86 V87 R88 P89 H90 K91 H92 S98 R101 Q105 K118 G119 G120 R121 D125 R129 D132

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex