Structure of PDB 8d9v Chain S

Receptor sequence
>8d9vS (length=142) Species: 9606 (Homo sapiens) [Search protein sequence]
MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFV
DWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCE
LDIIFNFEKAYFILDEFIIGGEIQETSKKIAVKAIEDSDMLQ
3D structure
PDB8d9v Self-assembly and structure of a clathrin-independent AP-1:Arf1 tubular membrane coat.
ChainS
Resolution9.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide S Y62 V98 C99 E100 Y62 V98 C99 E100
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0035615 clathrin adaptor activity
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0060155 platelet dense granule organization
GO:1903232 melanosome assembly
Cellular Component
GO:0000139 Golgi membrane
GO:0005765 lysosomal membrane
GO:0005769 early endosome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005905 clathrin-coated pit
GO:0030117 membrane coat
GO:0030121 AP-1 adaptor complex
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0032588 trans-Golgi network membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8d9v, PDBe:8d9v, PDBj:8d9v
PDBsum8d9v
PubMed36269825
UniProtQ96PC3|AP1S3_HUMAN AP-1 complex subunit sigma-3 (Gene Name=AP1S3)

[Back to BioLiP]